MutT, E.coli (His-SUMO)
The MutT protein maintains the genome by hydrolyzing 8-oxo-deoxyguanosine triphosphate (8-oxo-dGTP) and 8-oxo-guanosine triphosphate (8-oxo-GTP) to their corresponding monophosphates. Integrity plays a key role. This prevents misincorporation of 8-oxoGua into DNA and RNA, ensuring the fidelity of the nucleotide library. MutT Protein, E.coli (His-SUMO) is the recombinant E. coli-derived MutT protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
Product Specifications
Product Name Alternative
MutT Protein, E.coli (His-SUMO), E.coli, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mutt-protein-e-coli-his-sumo.html
Smiles
MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKRL
Molecular Formula
944824 (Gene_ID) P08337 (M1-L129) (Accession)
Molecular Weight
Approximately 30.9 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Uncoated Human ENPP2 (Ectonucleotide Pyrophosphatase/Phosphodiesterase 2) ELISA Kit
Uncoated Human ENPP2 (Ectonucleotide Pyrophosphatase/Phosphodiesterase 2) ELISA Kit
