Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Angiogenin-1 (ANG1)

Product Specifications

Product Name Alternative

ANG1; ANGAngiogenin-1; EC 3.1.27.-

Abbreviation

Recombinant Bovine ANG1 protein

Gene Name

ANG1

UniProt

P10152

Expression Region

24-148aa

Organism

Bos taurus (Bovine)

Target Sequence

AQDDYRYIHFLTQHYDAKPKGRNDEYCFNMMKNRRLTRPCKDRNTFIHGNKNDIKAICEDRNGQPYRGDLRISKSEFQITICKHKGGSSRPPCRYGATEDSRVIVVGCENGLPVHFDESFITPRH

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Binds to actin on the surface of endothelial cells; once bound, angiogenin is endocytosed and translocated to the nucleus. Stimulates ribosomal RNA synthesis including that containing the initiation site sequences of 45S rRNA. Cleaves tRNA within anticodon loops to produce tRNA-derived stress-induced fragments (tiRNAs) which inhibit protein synthesis and triggers the assbly of stress granules (SGs) . Angiogenin induces vascularization of normal and malignant tissues. Angiogenic activity is regulated by interaction with RNH1 in vivo. Has very low ribonuclease activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds to actin on the surface of endothelial cells; once bound, angiogenin is endocytosed and translocated to the nucleus. Stimulates ribosomal RNA synthesis including that containing the initiation site sequences of 45S rRNA. Cleaves tRNA within anticodon loops to produce tRNA-derived stress-induced fragments (tiRNAs) which inhibit protein synthesis and triggers the assembly of stress granules (SGs) (By similarity) . Angiogenin induces vascularization of normal and malignant tissues. Angiogenic activity is regulated by interaction with RNH1 in vivo. Has very low ribonuclease activity.

Molecular Weight

21.5 kDa

References & Citations

Solution structure of bovine angiogenin by 1H nuclear magnetic resonance spectroscopy.Lequin O., Albaret C., Bontems F., Spik G., Lallemand J.-Y.Biochemistry 35:8870-8880 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal CD48/SLAMF2 Antibody [DyLight 594]
NBP1-76556DL594 0.1 mL

Rabbit Polyclonal CD48/SLAMF2 Antibody [DyLight 594]

Ask
View Details
WWC2 Knockout Cell Lysate
ABC-KC2330 100 µg

WWC2 Knockout Cell Lysate

Ask
View Details
Recombinant Haloferax volcanii DNA repair and recombination protein radA (radA)
MBS1474765-01 0.05 mg (E-Coli)

Recombinant Haloferax volcanii DNA repair and recombination protein radA (radA)

Ask
View Details
Recombinant Haloferax volcanii DNA repair and recombination protein radA (radA)
MBS1474765-02 0.05 mg (Yeast)

Recombinant Haloferax volcanii DNA repair and recombination protein radA (radA)

Ask
View Details
Recombinant Haloferax volcanii DNA repair and recombination protein radA (radA)
MBS1474765-03 0.2 mg (E-Coli)

Recombinant Haloferax volcanii DNA repair and recombination protein radA (radA)

Ask
View Details
Recombinant Haloferax volcanii DNA repair and recombination protein radA (radA)
MBS1474765-04 0.05 mg (Baculovirus)

Recombinant Haloferax volcanii DNA repair and recombination protein radA (radA)

Ask
View Details