Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Interleukin-6 protein (IL6) (Active)

Product Specifications

Product Name Alternative

IL-6

Abbreviation

Recombinant Rhesus macaque IL6 protein (Active)

Gene Name

IL6

UniProt

P51494

Expression Region

28-212aa

Organism

Macaca mulatta (Rhesus macaque)

Target Sequence

M+APVLPGEDSKNVAAPHSQPLTSSERIDKHIRYILDGISALRKETCNRSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEDTCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPEPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSNLRALRQM

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T (H) 17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation (By similarity) . {ECO:0000250}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>97% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay usingIL-6-dependent murine 7TD1 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 x 107 IU/mg.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered concentrated solution in 50 mM Tris-HCl, pH9.0, 600 mM NaCl, with 0.02 % Tween-20.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T (H) 17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation (By similarity) .

Molecular Weight

21.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGFBP3 (NM_001013398) Human Recombinant Protein
TP762047 50 µg

IGFBP3 (NM_001013398) Human Recombinant Protein

Sign In for Pricing
View Details
B7H3 (CD276) Human Gene Knockout Kit (CRISPR)
KN415064 1 Kit

B7H3 (CD276) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IRX1 Rabbit Polyclonal Antibody
AP20429PU-N 100 µg

IRX1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Trim32 Mouse Gene Knockout Kit (CRISPR)
KN318203RB 1 Kit

Trim32 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Glycidamide- 13C3
TRC-G615253-2.5MG 2.5 mg

Glycidamide- 13C3

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver
CS805191 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details