Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APEG1, Human (His)

APEG1 Isoform 3 potentially regulates the growth and differentiation of arterial smooth muscle cells. APEG1 Protein, Human (His) is the recombinant human-derived APEG1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

APEG1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apeg1-protein-human-his.html

Purity

98.0

Smiles

MKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRGE

Molecular Formula

10290 (Gene_ID) Q15772-4 (M1-E113) (Accession)

Molecular Weight

Approximately 15 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-(2-Chlorodibenzo[b,f][1,4]oxazepin-11-yl)-N-(2-(4-chlorophenoxy)phenyl)piperazine-1-carboxamide
TRC-C798030-100MG 100 mg

4-(2-Chlorodibenzo[b,f][1,4]oxazepin-11-yl)-N-(2-(4-chlorophenoxy)phenyl)piperazine-1-carboxamide

Sign In for Pricing
View Details
TEAD1 Recombinant Rabbit Monoclonal Antibody [JE45-37]
HA722144 100 µL

TEAD1 Recombinant Rabbit Monoclonal Antibody [JE45-37]

Sign In for Pricing
View Details
GRIK2 (NM_175768) Human Recombinant Protein
TP323048 20 µg

GRIK2 (NM_175768) Human Recombinant Protein

Sign In for Pricing
View Details
Ɑ-Hydroxy-ω-Pam₃Cys PEG
135000-00-8.100MG 100 mg

Ɑ-Hydroxy-ω-Pam₃Cys PEG

Sign In for Pricing
View Details
TET3 Rabbit Polyclonal Antibody
TA382436 100 µL

TET3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mgat5 Mouse Gene Knockout Kit (CRISPR)
KN310062LP 1 Kit

Mgat5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details