Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APEG1, Human (His)

APEG1 Isoform 3 potentially regulates the growth and differentiation of arterial smooth muscle cells. APEG1 Protein, Human (His) is the recombinant human-derived APEG1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

APEG1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apeg1-protein-human-his.html

Purity

98.0

Smiles

MKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRGE

Molecular Formula

10290 (Gene_ID) Q15772-4 (M1-E113) (Accession)

Molecular Weight

Approximately 15 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LDLRAD2 activation kit by CRISPRa
GA118351 1 Kit

Human LDLRAD2 activation kit by CRISPRa

Sign In for Pricing
View Details
Oxytocin-neurophysin 1 / OXT Recombinant Chimeric Antibody Antibody
HA601425 100 µL

Oxytocin-neurophysin 1 / OXT Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Human STEEP1 activation kit by CRISPRa
GA111924 1 Kit

Human STEEP1 activation kit by CRISPRa

Sign In for Pricing
View Details
TTC39A (NM_001080494) Human Over-expression Lysate
LY421049 100 µg

TTC39A (NM_001080494) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Salivary gland
CS800158 5x 5 µm

Tissue FFPE Sections, Salivary gland

Sign In for Pricing
View Details
Fencamfamin-d5 Hydrochloride
TRC-F247272-5MG 5 mg

Fencamfamin-d5 Hydrochloride

Sign In for Pricing
View Details