Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APEG1, Human (His)

APEG1 Isoform 3 potentially regulates the growth and differentiation of arterial smooth muscle cells. APEG1 Protein, Human (His) is the recombinant human-derived APEG1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

APEG1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apeg1-protein-human-his.html

Purity

98.0

Smiles

MKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRGE

Molecular Formula

10290 (Gene_ID) Q15772-4 (M1-E113) (Accession)

Molecular Weight

Approximately 15 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Human CD274/PD-L1 Antibody[29E.2A3]
E-AB-F1133D-01 20 Tests

PE Anti-Human CD274/PD-L1 Antibody[29E.2A3]

Sign In for Pricing
View Details
PE Anti-Human CD274/PD-L1 Antibody[29E.2A3]
E-AB-F1133D-02 100 Tests

PE Anti-Human CD274/PD-L1 Antibody[29E.2A3]

Sign In for Pricing
View Details
PE Anti-Human CD274/PD-L1 Antibody[29E.2A3]
E-AB-F1133D-03 2x 100 Tests

PE Anti-Human CD274/PD-L1 Antibody[29E.2A3]

Sign In for Pricing
View Details
D-Arabinose
TRC-A764175-5G 5 g

D-Arabinose

Sign In for Pricing
View Details
Frozen Tissue Sections, Rectum
CS505418 5x 5 µm

Frozen Tissue Sections, Rectum

Sign In for Pricing
View Details
GCDFP-15 (Gross Cystic Disease Fluid Protein 15) (Breast Marker) (PIP/1571), CF405S conjugate, 0.1mg/mL
BNC041571-500 1x 500 µL

GCDFP-15 (Gross Cystic Disease Fluid Protein 15) (Breast Marker) (PIP/1571), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details