Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APEG1, Human (His)

APEG1 Isoform 3 potentially regulates the growth and differentiation of arterial smooth muscle cells. APEG1 Protein, Human (His) is the recombinant human-derived APEG1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

APEG1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apeg1-protein-human-his.html

Purity

98.0

Smiles

MKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRGE

Molecular Formula

10290 (Gene_ID) Q15772-4 (M1-E113) (Accession)

Molecular Weight

Approximately 15 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cholesta-4,6-dien-3-one-d7
TRC-C431422-2.5MG 2.5 mg

Cholesta-4,6-dien-3-one-d7

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (66.4.C2), CF647 conjugate, 0.1mg/mL
BNC470287-500 1x 500 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (66.4.C2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Endometrium
CR559517 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details
PEMT Polyclonal Antibody
E-AB-18144-01 20 µL

PEMT Polyclonal Antibody

Sign In for Pricing
View Details
PEMT Polyclonal Antibody
E-AB-18144-02 60 µL

PEMT Polyclonal Antibody

Sign In for Pricing
View Details
PEMT Polyclonal Antibody
E-AB-18144-03 120 µL

PEMT Polyclonal Antibody

Sign In for Pricing
View Details