Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APEG1, Human (His)

APEG1 Isoform 3 potentially regulates the growth and differentiation of arterial smooth muscle cells. APEG1 Protein, Human (His) is the recombinant human-derived APEG1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

APEG1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apeg1-protein-human-his.html

Purity

98.0

Smiles

MKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRGE

Molecular Formula

10290 (Gene_ID) Q15772-4 (M1-E113) (Accession)

Molecular Weight

Approximately 15 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(+) -Catechin
GK0455-10mg 10 mg

(+) -Catechin

Sign In for Pricing
View Details
ATG7 Recombinant Protein
OPCD01532-50UG 50 µg

ATG7 Recombinant Protein

Sign In for Pricing
View Details
2-[ (4-cyanophenyl) amino]acetic acid
sc-340704 1 g

2-[ (4-cyanophenyl) amino]acetic acid

Sign In for Pricing
View Details
Rabbit Polyclonal EAAT1/GLAST-1/SLC1A3 Antibody [mFluor Violet 500 SE]
NBP2-98747MFV500 0.1 mL

Rabbit Polyclonal EAAT1/GLAST-1/SLC1A3 Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Beta-Tubulin Antibody
orb44542 0.1 mg

Beta-Tubulin Antibody

Sign In for Pricing
View Details
SR140 (U2SURP) (NM_001080415) Human Over-expression Lysate
E45H04766-2 20 µg

SR140 (U2SURP) (NM_001080415) Human Over-expression Lysate

Sign In for Pricing
View Details