Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERP29, Human (GST)

Product Specifications

UNSPSC Description

Contrary to expectations, the ERP29 protein does not exhibit disulfide isomerase activity. Its function is critical in the processing of secreted proteins within the endoplasmic reticulum (ER) and may contribute to the folding of proteins in this cellular compartment. ERP29 Protein, Human (GST) is the recombinant human-derived ERP29 protein, expressed by E. coli , with N-GST labeled tag.

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/erp29-protein-human-gst.html

Smiles

PLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAF

Molecular Weight

Approximately 51.0 kDa

Shipping Conditions

Room temperature

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppp3cb (NM_008914) Mouse Tagged ORF Clone Lentiviral Particle
MR208424L4V 200 µL

Ppp3cb (NM_008914) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Txndc10 (BC057139) Mouse Tagged ORF Clone
MR203863 10 µg

Txndc10 (BC057139) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal PSMA7 Antibody (OTI3F11) [DyLight 550]
NBP2-73693R 0.1 mL

Mouse Monoclonal PSMA7 Antibody (OTI3F11) [DyLight 550]

Sign In for Pricing
View Details
KDR Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV694393 1.0 µg DNA

KDR Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Foliglurax
MF-0022325-01 25 mg

Foliglurax

Sign In for Pricing
View Details
Foliglurax
MF-0022325-02 50 mg

Foliglurax

Sign In for Pricing
View Details