Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Urocortin III, mouse (TFA)

Urocortin III, mouse TFA is a corticotropin-releasing factor (CRF) -related peptide. Urocortin III preferentially binds and activates CRF-R2[1]. Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics[2].

Product Specifications

UNSPSC

12352209

Target

CRFR

Type

Peptides

Related Pathways

GPCR/G Protein

Applications

Metabolism-protein/nucleotide metabolism

Field of Research

Neurological Disease; Cardiovascular Disease; Endocrinology

Assay Protocol

https://www.medchemexpress.com/urocortin-iii-mouse-tfa.html

Purity

95.93

Solubility

H2O : 25 mg/mL (ultrasonic)

Smiles

[FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2(TFAsalt)]

Molecular Formula

C186H312N52O52S2.xC2HF3O2

Molecular Weight

4172.97 (free base)

References & Citations

[1]Proc Natl Acad Sci U S A. 2001 Jun 19;98 (13) :7570-5. Lewis K, et al. Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor. Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor.|[2]Shemesh Y, et al. Ucn3 and CRF-R2 in the medial amygdala regulate complex social dynamics. Nat Neurosci. 2016 Nov;19 (11) :1489-1496.

Shipping Conditions

Blue Ice

Storage Conditions

-80°C, 2 years; -20°C, 1 year (Powder, sealed storage, away from moisture)

Scientific Category

Peptides

Clinical Information

No Development Reported

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL
BNC470525-100 1x 100 µL

CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL
BNC400630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF488A conjugate, 0.1mg/mL
BNC880012-500 1x 500 µL

Tyrosinase (T311), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Desmin (Muscle Cell Marker) (DES/2960R), CF488A conjugate, 0.1mg/mL
BNC882960-500 1x 500 µL

Desmin (Muscle Cell Marker) (DES/2960R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM (NCAM1/784), CF568 conjugate, 0.1mg/mL
BNC680784-500 1x 500 µL

CD56 / NCAM (NCAM1/784), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (HCAM/918), CF568 conjugate, 0.1mg/mL
BNC680918-100 1x 100 µL

CD44 Standard (HCAM/918), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details