Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPB11, Human (His)

The HSPB11 protein is an important component of IFT complex B and is indispensable for sonic eager/SHH signaling. It promotes intraflagellar transport in ciliated tissues such as kidney and testis, mediating the transport of SHH components. HSPB11 Protein, Human (His) is the recombinant human-derived HSPB11 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HSPB11 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hspb11-protein-human-his.html

Smiles

MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS

Molecular Formula

51668 (Gene_ID) Q9Y547 (M1-S144) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP5J2 Protein Vector (Mouse) (pPM-C-His)
PV157357 500 ng

ATP5J2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Secretin Peptide
350378 1 mg

Secretin Peptide

Sign In for Pricing
View Details
SLCO1B1 (Biotin)
577055-01 50 µg

SLCO1B1 (Biotin)

Sign In for Pricing
View Details
SLCO1B1 (Biotin)
577055-02 100 µg

SLCO1B1 (Biotin)

Sign In for Pricing
View Details
Human Prefoldin Subunit 2 (PFDN2) ELISA Kit
MBS4503795-01 48 Tests

Human Prefoldin Subunit 2 (PFDN2) ELISA Kit

Sign In for Pricing
View Details
Human Prefoldin Subunit 2 (PFDN2) ELISA Kit
MBS4503795-02 96 Tests

Human Prefoldin Subunit 2 (PFDN2) ELISA Kit

Sign In for Pricing
View Details