Parathyroid Hormone (1 - 34) (human) - FAM labeled

<strong>Parathyroid Hormone (1 - 34) (human) - FAM labeled</strong>_x000D_ <strong>Catalog number:</strong> B2019430_x000D_ <strong>Lot number:</strong> Batch Dependent_x000D_ <strong>Expiration Date:</strong> Batch dependent_x000D_ <strong>Amount:</strong> 1 mg_x000D_ <strong>Molecular Weight or Concentration:</strong> 4476.1_x000D_ <strong>Supplied as:</strong> Powder_x000D_ <strong>Applications:</strong> a molecular tool for various biochemical applications_x000D_ <strong>Storage:</strong> -20°C_x000D_ <strong>Keywords:</strong> FAM-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF_x000D_ <strong>Grade:</strong> Biotechnology grade. All products are highly pure. All solutions are made with Type I ultrapure water (resistivity &gt;18 MΩ-cm) and are filtered through 0.22 um._x000D_ _x000D_ <strong>References:</strong>_x000D_ 1: Beth-Tasdogan NH, Mayer B, Hussein H, Zolk O, Peter JU. Interventions for managing medication-related osteonecrosis of the jaw Cochrane Database Syst Rev. 2022 Jul 12;7(7):CD012432._x000D_ 2: Kanaori K, Takai M, Nosaka AY. Comparative study of chicken and human parathyroid hormone-(1-34)-peptides in solution with SDS Eur J Biochem. 1997 Nov 1;249(3):878-85._x000D_ 3: Liu C, Shao G, Lu Y, Xue M, Liang F, Zhang Z, Bai L. Parathyroid Hormone-Related Protein (1-40) Enhances Calcium Uptake in Rat Enterocytes Through PTHR1 Receptor and Protein Kinase Cα/β Signaling Cell Physiol Biochem. 2018;51(4):1695-1709._x000D_ 4: Hayes MA, Polson TN, Phayre AN, Garcia AA. Flow-based microimmunoassay Anal Chem. 2001 Dec 15;73(24):5896-902._x000D_ 5: Nie Y, Li J, Liu Y, Zhang Q, Ma Q. A Visual FRET Immunofluorescent Biosensor for Ratiometric Parathyroid Hormone (1-84) Antigen Point-of-Care Detection J Fluoresc. 2020 Mar;30(2):329-334._x000D_ 6: Shao JS, Cheng SL, Charlton-Kachigian N, Loewy AP, Towler DA. Teriparatide (human parathyroid hormone (1-34)) inhibits osteogenic vascular calcification in diabetic low density lipoprotein receptor-deficient mice J Biol Chem. 2003 Dec 12;278(50):50195-202._x000D_ 7: Lavazza M, Liu X, Wu C, Anuwong A, Kim HY, Liu R, Randolph GW, Inversini D, Boni L, Rausei S, Frattini F, Dionigi G. Indocyanine green-enhanced fluorescence for assessing parathyroid perfusion during thyroidectomy Gland Surg. 2016 Oct;5(5):512-521._x000D_ 8: Ejersted C, Andreassen TT, Nilsson MH, Oxlund H. Human parathyroid hormone(1-34) increases bone formation and strength of cortical bone in aged rats Eur J Endocrinol. 1994 Feb;130(2):201-7._x000D_ 9: Culhane KJ, Belina ME, Sims JN, Cai Y, Liu Y, Wang PSP, Yan ECY. Parathyroid Hormone Senses Extracellular Calcium To Modulate Endocrine Signaling upon Binding to the Family B GPCR Parathyroid Hormone 1 Receptor ACS Chem Biol. 2018 Aug 17;13(8):2347-2358._x000D_ <a href="https://pubmed.ncbi.nlm.nih.gov/33609395">10: Demarchi MS, Karenovics W, Bédat B, De Vito C, Triponez F. Autofluorescence pattern of parathyroid adenomas BJS Open. 2021 Jan 8;5(1):zraa047. </a>_x000D_ _x000D_ <strong>Products Related to Parathyroid Hormone (1 - 34) (human) - FAM labeled can be found at</strong> <a href="https://moleculardepot.com/product-category/Peptides/"> Peptides</a>