GITR, Human (HEK293, hFc)

GITR (TNFRSF18) is a member of the TNFR superfamily. GITR promotes T cell activation and proliferation and increases resistance to tumors and viral infections, and exacerbates autoimmune diseases and inflammation processes[1]. GITR Protein, Human (HEK293, hFc) is a recombinant protein with a C-terminal Fc label, It consists of 136 amino acids (Q26-E161) and is produced in HEK293 cells.

Product Specifications

Product Name Alternative

GITR Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gitr-protein-human-hek-293-fc.html

Purity

95.0

Smiles

QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAE

Molecular Formula

8784 (Gene_ID) Q9Y5U5 (Q26-E161) (Accession)

Molecular Weight

42-50 kDa

References & Citations

[1]Tian J, et al. The Role of GITR/GITRL Interaction in Autoimmune Diseases. Front Immunol. 2020 Oct 9;11:588682.|[2]Krausz LT, et al. GITR-GITRL system, a novel player in shock and inflammation. ScientificWorldJournal. 2007 May 1;7:533-66.|[3]Shin HH, et al. Recombinant glucocorticoid induced tumor necrosis factor receptor (rGITR) induces NOS in murine macrophage. FEBS Lett. 2002 Mar 13;514 (2-3) :275-80.|[4]Liu Y, et al. Novel tumor suppressor function of glucocorticoid-induced TNF receptor GITR in multiple myeloma. PLoS One. 2013 Jun 13;8 (6) :e66982.