Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLT3LG, Human

FLT3LG protein, a potent stimulator of early hematopoietic cell proliferation, activates FLT3 and synergizes with colony-stimulating factors and interleukins. As a homodimer, especially in isoform 2, it crucially promotes expansion and differentiation of hematopoietic progenitor cells. FLT3LG's collaborative signaling with other molecules underscores its significance in regulating hematopoiesis and maintaining hematopoietic system balance. FLT3LG Protein, Human is the recombinant human-derived FLT3LG protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FLT3LG Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/flt-3-ligand-protein-human-his.html

Purity

95.00

Smiles

TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA

Molecular Formula

2323 (Gene_ID) P49771-1 (T27-A181) (Accession)

Molecular Weight

Approximately 17.61 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Glucuronic Acid Epimerase (GLCE) CLIA Kit
abx495598-01 96 Tests

Rat Glucuronic Acid Epimerase (GLCE) CLIA Kit

Sign In for Pricing
View Details
Rat Glucuronic Acid Epimerase (GLCE) CLIA Kit
abx495598-02 5x 96 Tests

Rat Glucuronic Acid Epimerase (GLCE) CLIA Kit

Sign In for Pricing
View Details
Rat Glucuronic Acid Epimerase (GLCE) CLIA Kit
abx495598-03 10x 96 Tests

Rat Glucuronic Acid Epimerase (GLCE) CLIA Kit

Sign In for Pricing
View Details
Rat Rabepk ELISA Kit
ELI-30469r 96 Tests

Rat Rabepk ELISA Kit

Sign In for Pricing
View Details
Polr3b Mouse Gene Knockout Kit (CRISPR)
KN513611 1 Kit

Polr3b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MIR320B-1 Human MicroRNA Expression Plasmid (MI0003776)
SC400331 10 µg

MIR320B-1 Human MicroRNA Expression Plasmid (MI0003776)

Sign In for Pricing
View Details