Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLT3LG, Human

FLT3LG protein, a potent stimulator of early hematopoietic cell proliferation, activates FLT3 and synergizes with colony-stimulating factors and interleukins. As a homodimer, especially in isoform 2, it crucially promotes expansion and differentiation of hematopoietic progenitor cells. FLT3LG's collaborative signaling with other molecules underscores its significance in regulating hematopoiesis and maintaining hematopoietic system balance. FLT3LG Protein, Human is the recombinant human-derived FLT3LG protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FLT3LG Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/flt-3-ligand-protein-human-his.html

Purity

95.00

Smiles

TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA

Molecular Formula

2323 (Gene_ID) P49771-1 (T27-A181) (Accession)

Molecular Weight

Approximately 17.61 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TNFR-S274 (TNFRSF1A, TNFAR, TNFR1, Tumor necrosis factor receptor superfamily member 1A, Tumor necrosis factor receptor 1, Tumor necrosis factor receptor type I, p55, p60, CD120a, Tumor necrosis factor receptor superfamily member 1A, membrane form, Tumor necrosis factor-binding protein 1) (MaxLight 550) discontinued
043068-ML550 100 µL

TNFR-S274 (TNFRSF1A, TNFAR, TNFR1, Tumor necrosis factor receptor superfamily member 1A, Tumor necrosis factor receptor 1, Tumor necrosis factor receptor type I, p55, p60, CD120a, Tumor necrosis factor receptor superfamily member 1A, membrane form, Tumor necrosis factor-binding protein 1) (MaxLight 550) discontinued

Ask
View Details
TTC32 Mouse Monoclonal Antibody [Clone ID: OTI3C2]
CF501342 100 µg

TTC32 Mouse Monoclonal Antibody [Clone ID: OTI3C2]

Ask
View Details
CNKSR1 Human siRNA Oligo Duplex (Locus ID 10256)
SR306942 1 Kit

CNKSR1 Human siRNA Oligo Duplex (Locus ID 10256)

Ask
View Details
Mouse Monoclonal CD133 Antibody (170411) [FITC]
FAB11331F 0.1 mL

Mouse Monoclonal CD133 Antibody (170411) [FITC]

Ask
View Details
ADAMTS13 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-5856R-PerCP-Cy5.5 100 µL

ADAMTS13 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Ask
View Details