Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLT3LG, Human

FLT3LG protein, a potent stimulator of early hematopoietic cell proliferation, activates FLT3 and synergizes with colony-stimulating factors and interleukins. As a homodimer, especially in isoform 2, it crucially promotes expansion and differentiation of hematopoietic progenitor cells. FLT3LG's collaborative signaling with other molecules underscores its significance in regulating hematopoiesis and maintaining hematopoietic system balance. FLT3LG Protein, Human is the recombinant human-derived FLT3LG protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FLT3LG Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/flt-3-ligand-protein-human-his.html

Purity

95.00

Smiles

TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA

Molecular Formula

2323 (Gene_ID) P49771-1 (T27-A181) (Accession)

Molecular Weight

Approximately 17.61 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Porcine IL-6R (Interleukin 6 Receptor) ValidElisa Kit
EK344067 96 Well

Porcine IL-6R (Interleukin 6 Receptor) ValidElisa Kit

Ask
View Details
Rabbit Polyclonal NLRX1 Antibody
NBP3-12566-100ul 100 µL

Rabbit Polyclonal NLRX1 Antibody

Ask
View Details
pCMV-3×FLAG-ZDHHC23-Neo Plasmid
PVT57781 2 µg

pCMV-3×FLAG-ZDHHC23-Neo Plasmid

Ask
View Details
POLR1E, ID (POLR1E, PAF53, PRAF1, DNA-directed RNA polymerase I subunit RPA49, DNA-directed RNA polymerase I subunit E, RNA polymerase I-associated factor 1, RNA polymerase I-associated factor 53) (PE) discontinued
040254-PE 200 µL

POLR1E, ID (POLR1E, PAF53, PRAF1, DNA-directed RNA polymerase I subunit RPA49, DNA-directed RNA polymerase I subunit E, RNA polymerase I-associated factor 1, RNA polymerase I-associated factor 53) (PE) discontinued

Ask
View Details