Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Rat (HEK293, His)

CTLA-4 protein inhibits T-cell responses by binding strongly to CD80 and CD86 receptors, surpassing CD28. This affinity allows CTLA-4 to effectively regulate T-cell activation and immune responses. The balance between inhibitory and stimulatory signals controlled by CTLA-4 and its ligands modulates T-cell-mediated immune reactions. CTLA-4 Protein, Rat (HEK293, His) is the recombinant rat-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-rat-hek293-his.html

Purity

95.00

Smiles

EAIQVTQPSVVLASSHGVASFPCEYASSHNTDEVRVTVLRQTNDQVTEVCATTFTVKNTLGFLDDPFCSGTFNESRVNLTIQGLRAADTGLYFCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Molecular Formula

63835 (Gene_ID) Q62859 (E36-D161) (Accession)

Molecular Weight

Approximately 21-30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Senp8 (NM_027838) Mouse Tagged ORF Clone
MG216413 10 µg

Senp8 (NM_027838) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Epha7 shRNA (UAS) - Lentiviral mouse Epha7 shRNA (UAS, RFP) plasmid
GTR15251053 1 Vial

Lentiviral mouse Epha7 shRNA (UAS) - Lentiviral mouse Epha7 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Human IFIT1B knockdown cell line
ABC-KD7171 1 Vial

Human IFIT1B knockdown cell line

Sign In for Pricing
View Details
VMO1 Protein (C-mouse IgG1-Fc, Human)
P529500 100 µg

VMO1 Protein (C-mouse IgG1-Fc, Human)

Sign In for Pricing
View Details
CRBN ligand-1
HY-150799 1 Each

CRBN ligand-1

Sign In for Pricing
View Details
Mouse Monoclonal Cadherin-17 Antibody (rCDH17/8514) [Alexa Fluor 700]
NBP3-20889AF700 0.1 mL

Mouse Monoclonal Cadherin-17 Antibody (rCDH17/8514) [Alexa Fluor 700]

Sign In for Pricing
View Details