Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Rat (HEK293, His)

CTLA-4 protein inhibits T-cell responses by binding strongly to CD80 and CD86 receptors, surpassing CD28. This affinity allows CTLA-4 to effectively regulate T-cell activation and immune responses. The balance between inhibitory and stimulatory signals controlled by CTLA-4 and its ligands modulates T-cell-mediated immune reactions. CTLA-4 Protein, Rat (HEK293, His) is the recombinant rat-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-rat-hek293-his.html

Purity

95.00

Smiles

EAIQVTQPSVVLASSHGVASFPCEYASSHNTDEVRVTVLRQTNDQVTEVCATTFTVKNTLGFLDDPFCSGTFNESRVNLTIQGLRAADTGLYFCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Molecular Formula

63835 (Gene_ID) Q62859 (E36-D161) (Accession)

Molecular Weight

Approximately 21-30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Ribophorin I Antibody (OTI5B1) [Janelia Fluor 646]
NBP2-73905JF646 0.1 mL

Mouse Monoclonal Ribophorin I Antibody (OTI5B1) [Janelia Fluor 646]

Sign In for Pricing
View Details
CD1d Polyclonal Antibody, PE Conjugated
bs-4961R-PE 100 µL

CD1d Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Sheep anti-Rabbit IgG (H&L), Affinity purified, Unconjugated
AS10 1534 2 mg

Sheep anti-Rabbit IgG (H&L), Affinity purified, Unconjugated

Sign In for Pricing
View Details
LECT2 (Biotin)
567090-01 50 µg

LECT2 (Biotin)

Sign In for Pricing
View Details
LECT2 (Biotin)
567090-02 100 µg

LECT2 (Biotin)

Sign In for Pricing
View Details
TMED4 Protein, Human, Recombinant (mFc Tag)
MBS8121517-01 0.1 mg

TMED4 Protein, Human, Recombinant (mFc Tag)

Sign In for Pricing
View Details