Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Rat (HEK293, His)

CTLA-4 protein inhibits T-cell responses by binding strongly to CD80 and CD86 receptors, surpassing CD28. This affinity allows CTLA-4 to effectively regulate T-cell activation and immune responses. The balance between inhibitory and stimulatory signals controlled by CTLA-4 and its ligands modulates T-cell-mediated immune reactions. CTLA-4 Protein, Rat (HEK293, His) is the recombinant rat-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-rat-hek293-his.html

Purity

95.00

Smiles

EAIQVTQPSVVLASSHGVASFPCEYASSHNTDEVRVTVLRQTNDQVTEVCATTFTVKNTLGFLDDPFCSGTFNESRVNLTIQGLRAADTGLYFCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Molecular Formula

63835 (Gene_ID) Q62859 (E36-D161) (Accession)

Molecular Weight

Approximately 21-30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFATc4 (phospho Ser676) Polyclonal Antibody
UB-GEN-1266 100 µL

NFATc4 (phospho Ser676) Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human ZFAND5 Protein
E30P1979 20 µg

Recombinant Human ZFAND5 Protein

Sign In for Pricing
View Details
COL18A1 Antibody
A76882-100UL 100 µL

COL18A1 Antibody

Sign In for Pricing
View Details
EEF2 Rabbit Polyclonal Antibody
TA384133 100 µL

EEF2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tbx2 3'UTR Lenti-reporter-Luc Vector
46303084 1.0 µg

Tbx2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
DEFB126 Antibody, FITC conjugated
MBS7104303-01 0.05 mg

DEFB126 Antibody, FITC conjugated

Sign In for Pricing
View Details