CTLA-4, Rat (HEK293, His)
CTLA-4 protein inhibits T-cell responses by binding strongly to CD80 and CD86 receptors, surpassing CD28. This affinity allows CTLA-4 to effectively regulate T-cell activation and immune responses. The balance between inhibitory and stimulatory signals controlled by CTLA-4 and its ligands modulates T-cell-mediated immune reactions. CTLA-4 Protein, Rat (HEK293, His) is the recombinant rat-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
CTLA-4 Protein, Rat (HEK293, His), Rat, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ctla-4-protein-rat-hek293-his.html
Purity
95.00
Smiles
EAIQVTQPSVVLASSHGVASFPCEYASSHNTDEVRVTVLRQTNDQVTEVCATTFTVKNTLGFLDDPFCSGTFNESRVNLTIQGLRAADTGLYFCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD
Molecular Formula
63835 (Gene_ID) Q62859 (E36-D161) (Accession)
Molecular Weight
Approximately 21-30 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
CD41 (CD41, CD41B, GP2B, GPalpha IIb, GPIIb, GTA, HPA3, integrin alpha 2b, Integrin alpha-IIb, Integrin alpha-IIb heavy chain, Integrin alpha-IIb light chain, form 1, Integrin alpha-IIb light chain, form 2, integrin, alpha 2b (platelet Glycoprotein IIb of IIb/IIIa Complex, antigen CD41), ITA2B, ITGA2B, ITGAB, platelet fibrinogen Receptor, alpha Subunit, Platelet Membrane Glycoprotein IIb, platelet-specific antigen BAK) (FITC)
Lentiviral mouse Nr3c2 shRNA (UAS) - Lentiviral mouse Nr3c2 shRNA (UAS, RFP) (100)