Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Rat (HEK293, His)

CTLA-4 protein inhibits T-cell responses by binding strongly to CD80 and CD86 receptors, surpassing CD28. This affinity allows CTLA-4 to effectively regulate T-cell activation and immune responses. The balance between inhibitory and stimulatory signals controlled by CTLA-4 and its ligands modulates T-cell-mediated immune reactions. CTLA-4 Protein, Rat (HEK293, His) is the recombinant rat-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-rat-hek293-his.html

Purity

95.00

Smiles

EAIQVTQPSVVLASSHGVASFPCEYASSHNTDEVRVTVLRQTNDQVTEVCATTFTVKNTLGFLDDPFCSGTFNESRVNLTIQGLRAADTGLYFCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Molecular Formula

63835 (Gene_ID) Q62859 (E36-D161) (Accession)

Molecular Weight

Approximately 21-30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEDD Antibody
A19191-50UL 50 μL

DEDD Antibody

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C4D7.11 (SPAC4D7.11), partial
MBS7069759 Inquire

Recombinant Schizosaccharomyces pombe Uncharacterized protein C4D7.11 (SPAC4D7.11), partial

Sign In for Pricing
View Details
Recombinant Human DTYMK Protein
E30P1679 20 µg

Recombinant Human DTYMK Protein

Sign In for Pricing
View Details
Hbq1b Protein Vector (Mouse) (pPM-C-HA)
PV188040 500 ng

Hbq1b Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Cavy Prospero Homeobox 2 (PROX2) ELISA Kit
MBS9919957 Inquire

Cavy Prospero Homeobox 2 (PROX2) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Ankrd23 shRNA (UAS) - Lentiviral mouse Ankrd23 shRNA (UAS, iRFP) plasmid
GTR15295123 1 Vial

Lentiviral mouse Ankrd23 shRNA (UAS) - Lentiviral mouse Ankrd23 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details