Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Rat (HEK293, His)

CTLA-4 protein inhibits T-cell responses by binding strongly to CD80 and CD86 receptors, surpassing CD28. This affinity allows CTLA-4 to effectively regulate T-cell activation and immune responses. The balance between inhibitory and stimulatory signals controlled by CTLA-4 and its ligands modulates T-cell-mediated immune reactions. CTLA-4 Protein, Rat (HEK293, His) is the recombinant rat-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-rat-hek293-his.html

Purity

95.00

Smiles

EAIQVTQPSVVLASSHGVASFPCEYASSHNTDEVRVTVLRQTNDQVTEVCATTFTVKNTLGFLDDPFCSGTFNESRVNLTIQGLRAADTGLYFCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Molecular Formula

63835 (Gene_ID) Q62859 (E36-D161) (Accession)

Molecular Weight

Approximately 21-30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAC1 (NM_013997) Human 3' UTR Clone
SC207403 10 µg

TAC1 (NM_013997) Human 3' UTR Clone

Sign In for Pricing
View Details
Vimentin Rabbit anti-Human Polyclonal Antibody
MBS2403162-01 0.05 mg

Vimentin Rabbit anti-Human Polyclonal Antibody

Sign In for Pricing
View Details
Vimentin Rabbit anti-Human Polyclonal Antibody
MBS2403162-02 5x 0.05 mg

Vimentin Rabbit anti-Human Polyclonal Antibody

Sign In for Pricing
View Details
Flatstem Milkvetch Seed Extract
C02412 5 mg

Flatstem Milkvetch Seed Extract

Sign In for Pricing
View Details
FRA9B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV725880 1.0 µg DNA

FRA9B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Eukaryotic Short Palate, Lung And Nasal Epithelium Carcinoma Associated Protein 2 (SPLUNC2)
SFPT415Hu61-01 10 µg

Eukaryotic Short Palate, Lung And Nasal Epithelium Carcinoma Associated Protein 2 (SPLUNC2)

Sign In for Pricing
View Details