Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Rat (HEK293, His)

CTLA-4 protein inhibits T-cell responses by binding strongly to CD80 and CD86 receptors, surpassing CD28. This affinity allows CTLA-4 to effectively regulate T-cell activation and immune responses. The balance between inhibitory and stimulatory signals controlled by CTLA-4 and its ligands modulates T-cell-mediated immune reactions. CTLA-4 Protein, Rat (HEK293, His) is the recombinant rat-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-rat-hek293-his.html

Purity

95.00

Smiles

EAIQVTQPSVVLASSHGVASFPCEYASSHNTDEVRVTVLRQTNDQVTEVCATTFTVKNTLGFLDDPFCSGTFNESRVNLTIQGLRAADTGLYFCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Molecular Formula

63835 (Gene_ID) Q62859 (E36-D161) (Accession)

Molecular Weight

Approximately 21-30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNIP1 (NM_014592) Human Tagged Lenti ORF Clone
RC208255L4 10 µg

KCNIP1 (NM_014592) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mercuric Iodide Red 98.5% Extrapure
01664 00250 250 g

Mercuric Iodide Red 98.5% Extrapure

Sign In for Pricing
View Details
Lentiviral mouse Cacng4 shRNA (UAS) - Lentiviral mouse Cacng4 shRNA (UAS, iRFP) (25)
GTR15255170 1 Vial

Lentiviral mouse Cacng4 shRNA (UAS) - Lentiviral mouse Cacng4 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Human RALGAPA2 qPCR Primer Pair
QH47601S 200 Tests

Human RALGAPA2 qPCR Primer Pair

Sign In for Pricing
View Details
Cluster of Differentiation 90 (CD90) Magnetic Fluorescence Assay Kit
MBS2157349-01 96 Tests

Cluster of Differentiation 90 (CD90) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Cluster of Differentiation 90 (CD90) Magnetic Fluorescence Assay Kit
MBS2157349-02 5x 96 Tests

Cluster of Differentiation 90 (CD90) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details