Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Rat (HEK293, His)

CTLA-4 protein inhibits T-cell responses by binding strongly to CD80 and CD86 receptors, surpassing CD28. This affinity allows CTLA-4 to effectively regulate T-cell activation and immune responses. The balance between inhibitory and stimulatory signals controlled by CTLA-4 and its ligands modulates T-cell-mediated immune reactions. CTLA-4 Protein, Rat (HEK293, His) is the recombinant rat-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-rat-hek293-his.html

Purity

95.00

Smiles

EAIQVTQPSVVLASSHGVASFPCEYASSHNTDEVRVTVLRQTNDQVTEVCATTFTVKNTLGFLDDPFCSGTFNESRVNLTIQGLRAADTGLYFCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Molecular Formula

63835 (Gene_ID) Q62859 (E36-D161) (Accession)

Molecular Weight

Approximately 21-30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human HLA-DQA2 Protein, His, E.coli-100ug
QP8816-ec-100ug 100ug

Recombinant Human HLA-DQA2 Protein, His, E.coli-100ug

Sign In for Pricing
View Details
hsa-miR-377-5p miRNA Mimic
MCH02085 2x 2.5 nmol

hsa-miR-377-5p miRNA Mimic

Sign In for Pricing
View Details
Proteasome 20S alpha 5 (PSMA5) (NM_002790) Human Over-expression Lysate
LY419118 100 µg

Proteasome 20S alpha 5 (PSMA5) (NM_002790) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit anti-K Cadherin Antibody
YLD4488-01 50 µL

Rabbit anti-K Cadherin Antibody

Sign In for Pricing
View Details
Rabbit anti-K Cadherin Antibody
YLD4488-02 100 µL

Rabbit anti-K Cadherin Antibody

Sign In for Pricing
View Details
Recombinant Bacillus anthracis UPF0473 protein BA_4613/GBAA_4613/BAS4281 (BA_4613, GBAA_4613, BAS4281)
MBS1457934-01 0.02 mg (E-Coli)

Recombinant Bacillus anthracis UPF0473 protein BA_4613/GBAA_4613/BAS4281 (BA_4613, GBAA_4613, BAS4281)

Sign In for Pricing
View Details