Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Rat (HEK293, His)

CTLA-4 protein inhibits T-cell responses by binding strongly to CD80 and CD86 receptors, surpassing CD28. This affinity allows CTLA-4 to effectively regulate T-cell activation and immune responses. The balance between inhibitory and stimulatory signals controlled by CTLA-4 and its ligands modulates T-cell-mediated immune reactions. CTLA-4 Protein, Rat (HEK293, His) is the recombinant rat-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-rat-hek293-his.html

Purity

95.00

Smiles

EAIQVTQPSVVLASSHGVASFPCEYASSHNTDEVRVTVLRQTNDQVTEVCATTFTVKNTLGFLDDPFCSGTFNESRVNLTIQGLRAADTGLYFCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Molecular Formula

63835 (Gene_ID) Q62859 (E36-D161) (Accession)

Molecular Weight

Approximately 21-30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human JMJD1C knockout cell line
ABC-KH7595 1 Vial

Human JMJD1C knockout cell line

Sign In for Pricing
View Details
Rat Aquaporin 5 (AQP-5) Elisa Kit
EK720670 96 Well

Rat Aquaporin 5 (AQP-5) Elisa Kit

Sign In for Pricing
View Details
Slc22a9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6363405 3x 1.0 µg

Slc22a9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Human Monocyte Chemoattractant Protein-induced Protein 1, MCPIP ELISA KIT
E7189Hu-01 48 Well

Human Monocyte Chemoattractant Protein-induced Protein 1, MCPIP ELISA KIT

Sign In for Pricing
View Details
Human Monocyte Chemoattractant Protein-induced Protein 1, MCPIP ELISA KIT
E7189Hu-02 96 Well

Human Monocyte Chemoattractant Protein-induced Protein 1, MCPIP ELISA KIT

Sign In for Pricing
View Details
Human Monocyte Chemoattractant Protein-induced Protein 1, MCPIP ELISA KIT
E7189Hu-03 5x 96 Tests

Human Monocyte Chemoattractant Protein-induced Protein 1, MCPIP ELISA KIT

Sign In for Pricing
View Details