Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Rat (HEK293, His)

CTLA-4 protein inhibits T-cell responses by binding strongly to CD80 and CD86 receptors, surpassing CD28. This affinity allows CTLA-4 to effectively regulate T-cell activation and immune responses. The balance between inhibitory and stimulatory signals controlled by CTLA-4 and its ligands modulates T-cell-mediated immune reactions. CTLA-4 Protein, Rat (HEK293, His) is the recombinant rat-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-rat-hek293-his.html

Purity

95.00

Smiles

EAIQVTQPSVVLASSHGVASFPCEYASSHNTDEVRVTVLRQTNDQVTEVCATTFTVKNTLGFLDDPFCSGTFNESRVNLTIQGLRAADTGLYFCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Molecular Formula

63835 (Gene_ID) Q62859 (E36-D161) (Accession)

Molecular Weight

Approximately 21-30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1295 Mouse Gene Knockout Kit (CRISPR)
KN511717 1 Kit

Olfr1295 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BAG6
307611-01 50 µL

BAG6

Sign In for Pricing
View Details
BAG6
307611-02 100 µL

BAG6

Sign In for Pricing
View Details
GALNT3, ID (GALNT3, Polypeptide N-acetylgalactosaminyltransferase 3, Polypeptide GalNAc transferase 3, Protein-UDP acetylgalactosaminyltransferase 3, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 3) (MaxLight 550) discontinued
035892-ML550 100 µL

GALNT3, ID (GALNT3, Polypeptide N-acetylgalactosaminyltransferase 3, Polypeptide GalNAc transferase 3, Protein-UDP acetylgalactosaminyltransferase 3, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 3) (MaxLight 550) discontinued

Sign In for Pricing
View Details
RN5S112 ORF Vector (Human) (pORF)
ORF028993 1.0 µg DNA

RN5S112 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Rat Monoclonal M-CSF R/CD115 Antibody (AFS98) [Biotin]
NBP1-43592-0.1mg 0.1 mg

Rat Monoclonal M-CSF R/CD115 Antibody (AFS98) [Biotin]

Sign In for Pricing
View Details