Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Rat (HEK293, His)

CTLA-4 protein inhibits T-cell responses by binding strongly to CD80 and CD86 receptors, surpassing CD28. This affinity allows CTLA-4 to effectively regulate T-cell activation and immune responses. The balance between inhibitory and stimulatory signals controlled by CTLA-4 and its ligands modulates T-cell-mediated immune reactions. CTLA-4 Protein, Rat (HEK293, His) is the recombinant rat-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-rat-hek293-his.html

Purity

95.00

Smiles

EAIQVTQPSVVLASSHGVASFPCEYASSHNTDEVRVTVLRQTNDQVTEVCATTFTVKNTLGFLDDPFCSGTFNESRVNLTIQGLRAADTGLYFCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Molecular Formula

63835 (Gene_ID) Q62859 (E36-D161) (Accession)

Molecular Weight

Approximately 21-30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX-9 Polyclonal Antibody
RD70345A-01 60 μL

SOX-9 Polyclonal Antibody

Sign In for Pricing
View Details
SOX-9 Polyclonal Antibody
RD70345A-02 120 μL

SOX-9 Polyclonal Antibody

Sign In for Pricing
View Details
SOX-9 Polyclonal Antibody
RD70345A-03 200 µL

SOX-9 Polyclonal Antibody

Sign In for Pricing
View Details
BTNL8, ID (BTNL8, Butyrophilin-like protein 8)
MBS6007574-01 0.2 mL

BTNL8, ID (BTNL8, Butyrophilin-like protein 8)

Sign In for Pricing
View Details
BTNL8, ID (BTNL8, Butyrophilin-like protein 8)
MBS6007574-02 5x 0.2 mL

BTNL8, ID (BTNL8, Butyrophilin-like protein 8)

Sign In for Pricing
View Details
Recombinant Human C-C motif chemokine 25 Protein, GST, E.coli-200ug
QP5774-ec-200ug 200ug

Recombinant Human C-C motif chemokine 25 Protein, GST, E.coli-200ug

Sign In for Pricing
View Details