Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Rat (HEK293, His)

CTLA-4 protein inhibits T-cell responses by binding strongly to CD80 and CD86 receptors, surpassing CD28. This affinity allows CTLA-4 to effectively regulate T-cell activation and immune responses. The balance between inhibitory and stimulatory signals controlled by CTLA-4 and its ligands modulates T-cell-mediated immune reactions. CTLA-4 Protein, Rat (HEK293, His) is the recombinant rat-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-rat-hek293-his.html

Purity

95.00

Smiles

EAIQVTQPSVVLASSHGVASFPCEYASSHNTDEVRVTVLRQTNDQVTEVCATTFTVKNTLGFLDDPFCSGTFNESRVNLTIQGLRAADTGLYFCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Molecular Formula

63835 (Gene_ID) Q62859 (E36-D161) (Accession)

Molecular Weight

Approximately 21-30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Myosin regulatory light chain 10, Myl10 ELISA KIT
ELI-38625m 96 Tests

Mouse Myosin regulatory light chain 10, Myl10 ELISA KIT

Sign In for Pricing
View Details
Desmin
MA1036-M 100μg

Desmin

Sign In for Pricing
View Details
RPS6KB1 (Ribosomal Protein S6 Kinase, 70kD, Polypeptide 1, PS6K, S6K, S6K1, STK14A, p70 (S6K) -alpha, p70-S6K, p70-alpha) (MaxLight 650)
251295-ML650 100 µL

RPS6KB1 (Ribosomal Protein S6 Kinase, 70kD, Polypeptide 1, PS6K, S6K, S6K1, STK14A, p70 (S6K) -alpha, p70-S6K, p70-alpha) (MaxLight 650)

Sign In for Pricing
View Details
β-2’-Deoxy Zebularine-13C,15N
469647-01 1 mg

β-2’-Deoxy Zebularine-13C,15N

Sign In for Pricing
View Details
β-2’-Deoxy Zebularine-13C,15N
469647-02 2.5 mg

β-2’-Deoxy Zebularine-13C,15N

Sign In for Pricing
View Details
SCNM1 cDNA Clone
MBS1272530-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

SCNM1 cDNA Clone

Sign In for Pricing
View Details