Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Rat (HEK293, His)

CTLA-4 protein inhibits T-cell responses by binding strongly to CD80 and CD86 receptors, surpassing CD28. This affinity allows CTLA-4 to effectively regulate T-cell activation and immune responses. The balance between inhibitory and stimulatory signals controlled by CTLA-4 and its ligands modulates T-cell-mediated immune reactions. CTLA-4 Protein, Rat (HEK293, His) is the recombinant rat-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-rat-hek293-his.html

Purity

95.00

Smiles

EAIQVTQPSVVLASSHGVASFPCEYASSHNTDEVRVTVLRQTNDQVTEVCATTFTVKNTLGFLDDPFCSGTFNESRVNLTIQGLRAADTGLYFCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Molecular Formula

63835 (Gene_ID) Q62859 (E36-D161) (Accession)

Molecular Weight

Approximately 21-30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isocitrate Lyase Assay Kit
abx298838 100 Assays

Isocitrate Lyase Assay Kit

Sign In for Pricing
View Details
NUDC Ser326 Rabbit Polyclonal Antibody
E53P05326 100 µL

NUDC Ser326 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DUSP12 Human siRNA Oligo Duplex (Locus ID 11266)
SR307730 1 Kit

DUSP12 Human siRNA Oligo Duplex (Locus ID 11266)

Sign In for Pricing
View Details
L-Leucine-d1
HY-N0486S11-01 1 mg

L-Leucine-d1

Sign In for Pricing
View Details
L-Leucine-d1
HY-N0486S11-02 5 mg

L-Leucine-d1

Sign In for Pricing
View Details
CRF1 (CRHR1) (NM_001145148) Human Tagged ORF Clone Lentiviral Particle
RC226962L4V 200 µL

CRF1 (CRHR1) (NM_001145148) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details