Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Rat (HEK293, His)

CTLA-4 protein inhibits T-cell responses by binding strongly to CD80 and CD86 receptors, surpassing CD28. This affinity allows CTLA-4 to effectively regulate T-cell activation and immune responses. The balance between inhibitory and stimulatory signals controlled by CTLA-4 and its ligands modulates T-cell-mediated immune reactions. CTLA-4 Protein, Rat (HEK293, His) is the recombinant rat-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-rat-hek293-his.html

Purity

95.00

Smiles

EAIQVTQPSVVLASSHGVASFPCEYASSHNTDEVRVTVLRQTNDQVTEVCATTFTVKNTLGFLDDPFCSGTFNESRVNLTIQGLRAADTGLYFCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Molecular Formula

63835 (Gene_ID) Q62859 (E36-D161) (Accession)

Molecular Weight

Approximately 21-30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fxyd2 3'UTR Luciferase Stable Cell Line
TU106798 1.0 mL

Fxyd2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
KRT8P2 Protein Vector (Human) (pPM-C-HA)
PV089856 500 ng

KRT8P2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Monoclonal HCN4 Antibody (2A5)
H00010021-M04 0.1 mg

Mouse Monoclonal HCN4 Antibody (2A5)

Sign In for Pricing
View Details
WST-8
2049-100 100 mg

WST-8

Sign In for Pricing
View Details
Cerk 3'UTR Luciferase Stable Cell Line
TU103752 1.0 mL

Cerk 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human RDBP, His-tagged
RDBP-2235H 25 µg

Recombinant Human RDBP, His-tagged

Sign In for Pricing
View Details