Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Rat (HEK293, His)

CTLA-4 protein inhibits T-cell responses by binding strongly to CD80 and CD86 receptors, surpassing CD28. This affinity allows CTLA-4 to effectively regulate T-cell activation and immune responses. The balance between inhibitory and stimulatory signals controlled by CTLA-4 and its ligands modulates T-cell-mediated immune reactions. CTLA-4 Protein, Rat (HEK293, His) is the recombinant rat-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-rat-hek293-his.html

Purity

95.00

Smiles

EAIQVTQPSVVLASSHGVASFPCEYASSHNTDEVRVTVLRQTNDQVTEVCATTFTVKNTLGFLDDPFCSGTFNESRVNLTIQGLRAADTGLYFCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Molecular Formula

63835 (Gene_ID) Q62859 (E36-D161) (Accession)

Molecular Weight

Approximately 21-30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LGALS3 Human Pre-designed siRNA Set A
HY-RS07604 1 Set

LGALS3 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
GPAM (Glycerol-3-phosphate Acyltransferase 1, Mitochondrial, GPAT-1, GPAT1, KIAA1560) discontinued
317724 100 µL

GPAM (Glycerol-3-phosphate Acyltransferase 1, Mitochondrial, GPAT-1, GPAT1, KIAA1560) discontinued

Sign In for Pricing
View Details
Rabbit Monoclonal Kynureninase Antibody (062) [DyLight 650]
NBP2-89680C 0.1 mL

Rabbit Monoclonal Kynureninase Antibody (062) [DyLight 650]

Sign In for Pricing
View Details
Commd1 3'UTR GFP Stable Cell Line
TU154207 1.0 mL

Commd1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Ikbip Mouse siRNA Oligo Duplex (Locus ID 67454)
SR411638 1 Kit

Ikbip Mouse siRNA Oligo Duplex (Locus ID 67454)

Sign In for Pricing
View Details
Lentiviral mouse Sstr2 shRNA (UAS) - Lentiviral mouse Sstr2 shRNA (UAS, RFP) (100)
GTR15181680 1 Vial

Lentiviral mouse Sstr2 shRNA (UAS) - Lentiviral mouse Sstr2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details