Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Rat (HEK293, His)

CTLA-4 protein inhibits T-cell responses by binding strongly to CD80 and CD86 receptors, surpassing CD28. This affinity allows CTLA-4 to effectively regulate T-cell activation and immune responses. The balance between inhibitory and stimulatory signals controlled by CTLA-4 and its ligands modulates T-cell-mediated immune reactions. CTLA-4 Protein, Rat (HEK293, His) is the recombinant rat-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-rat-hek293-his.html

Purity

95.00

Smiles

EAIQVTQPSVVLASSHGVASFPCEYASSHNTDEVRVTVLRQTNDQVTEVCATTFTVKNTLGFLDDPFCSGTFNESRVNLTIQGLRAADTGLYFCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Molecular Formula

63835 (Gene_ID) Q62859 (E36-D161) (Accession)

Molecular Weight

Approximately 21-30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mrps22 (NM_025485) Mouse Recombinant Protein
TP505496 20 µg

Mrps22 (NM_025485) Mouse Recombinant Protein

Sign In for Pricing
View Details
Lin9 (NM_001103182) Mouse Tagged ORF Clone
MR222299 10 µg

Lin9 (NM_001103182) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
GCG Antibody (N-term) Blocking Peptide
MBS9226115-01 0.5 mg

GCG Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
GCG Antibody (N-term) Blocking Peptide
MBS9226115-02 5x 0.5 mg

GCG Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
Defa9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6005505 3x 1.0 µg

Defa9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
C1orf55 Protein Vector (Human) (pPM-C-HA)
PV066235 500 ng

C1orf55 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details