Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Rat (HEK293, His)

CTLA-4 protein inhibits T-cell responses by binding strongly to CD80 and CD86 receptors, surpassing CD28. This affinity allows CTLA-4 to effectively regulate T-cell activation and immune responses. The balance between inhibitory and stimulatory signals controlled by CTLA-4 and its ligands modulates T-cell-mediated immune reactions. CTLA-4 Protein, Rat (HEK293, His) is the recombinant rat-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-rat-hek293-his.html

Purity

95.00

Smiles

EAIQVTQPSVVLASSHGVASFPCEYASSHNTDEVRVTVLRQTNDQVTEVCATTFTVKNTLGFLDDPFCSGTFNESRVNLTIQGLRAADTGLYFCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Molecular Formula

63835 (Gene_ID) Q62859 (E36-D161) (Accession)

Molecular Weight

Approximately 21-30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dnahc17 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3448708 1.0 µg DNA

Dnahc17 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Wdr37-set siRNA/shRNA/RNAi Lentivector (Mouse)
50326094 4x 500 ng

Wdr37-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
CRSP3 (Mediator of RNA Polymerase II Transcription Subunit 23, Activator-recruited Cofactor 130kD Component, ARC130, Cofactor Required for Sp1 Transcriptional Activation Subunit 3, CRSP Complex Subunit 3, Mediator Complex Subunit 23, Protein Sur-2 Homolog
MBS6200294-01 0.1 mL

CRSP3 (Mediator of RNA Polymerase II Transcription Subunit 23, Activator-recruited Cofactor 130kD Component, ARC130, Cofactor Required for Sp1 Transcriptional Activation Subunit 3, CRSP Complex Subunit 3, Mediator Complex Subunit 23, Protein Sur-2 Homolog

Sign In for Pricing
View Details
CRSP3 (Mediator of RNA Polymerase II Transcription Subunit 23, Activator-recruited Cofactor 130kD Component, ARC130, Cofactor Required for Sp1 Transcriptional Activation Subunit 3, CRSP Complex Subunit 3, Mediator Complex Subunit 23, Protein Sur-2 Homolog
MBS6200294-02 5x 0.1 mL

CRSP3 (Mediator of RNA Polymerase II Transcription Subunit 23, Activator-recruited Cofactor 130kD Component, ARC130, Cofactor Required for Sp1 Transcriptional Activation Subunit 3, CRSP Complex Subunit 3, Mediator Complex Subunit 23, Protein Sur-2 Homolog

Sign In for Pricing
View Details
casein kinase Iε CRISPR Activation Plasmid (h2)
sc-402163-ACT-2 20 µg

casein kinase Iε CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Lentiviral human C2CD5 shRNA (UAS) - Lentiviral human C2CD5 shRNA (UAS, iRFP) plasmid
GTR15152272 1 Vial

Lentiviral human C2CD5 shRNA (UAS) - Lentiviral human C2CD5 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details