Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Rat (HEK293, His)

CTLA-4 protein inhibits T-cell responses by binding strongly to CD80 and CD86 receptors, surpassing CD28. This affinity allows CTLA-4 to effectively regulate T-cell activation and immune responses. The balance between inhibitory and stimulatory signals controlled by CTLA-4 and its ligands modulates T-cell-mediated immune reactions. CTLA-4 Protein, Rat (HEK293, His) is the recombinant rat-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-rat-hek293-his.html

Purity

95.00

Smiles

EAIQVTQPSVVLASSHGVASFPCEYASSHNTDEVRVTVLRQTNDQVTEVCATTFTVKNTLGFLDDPFCSGTFNESRVNLTIQGLRAADTGLYFCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Molecular Formula

63835 (Gene_ID) Q62859 (E36-D161) (Accession)

Molecular Weight

Approximately 21-30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Bromo-4-cyanopyridine
160469 250 mg

3-Bromo-4-cyanopyridine

Sign In for Pricing
View Details
SEPT12 (Septin-12)
491426 100 µL

SEPT12 (Septin-12)

Sign In for Pricing
View Details
Pinaverium-d4 Bromide
sc-219623 1 mg

Pinaverium-d4 Bromide

Sign In for Pricing
View Details
Pfkfb3 ORF Vector (Rat) (pORF)
ORF073385 1.0 µg DNA

Pfkfb3 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Fat2 Mouse shRNA Plasmid (Locus ID 245827)
TR517529 1 Kit

Fat2 Mouse shRNA Plasmid (Locus ID 245827)

Sign In for Pricing
View Details
Slc17a2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6416807 1.0 µg DNA

Slc17a2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details