CTLA-4, Rat (HEK293, His)
CTLA-4 protein inhibits T-cell responses by binding strongly to CD80 and CD86 receptors, surpassing CD28. This affinity allows CTLA-4 to effectively regulate T-cell activation and immune responses. The balance between inhibitory and stimulatory signals controlled by CTLA-4 and its ligands modulates T-cell-mediated immune reactions. CTLA-4 Protein, Rat (HEK293, His) is the recombinant rat-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
CTLA-4 Protein, Rat (HEK293, His), Rat, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ctla-4-protein-rat-hek293-his.html
Purity
95.00
Smiles
EAIQVTQPSVVLASSHGVASFPCEYASSHNTDEVRVTVLRQTNDQVTEVCATTFTVKNTLGFLDDPFCSGTFNESRVNLTIQGLRAADTGLYFCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD
Molecular Formula
63835 (Gene_ID) Q62859 (E36-D161) (Accession)
Molecular Weight
Approximately 21-30 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
FATE1 (Fetal and Adult Testis Expressed 1, FATE) (APC)
FATE1 (Fetal and Adult Testis Expressed 1, FATE) (APC)
Acsm1 Rat shRNA Lentiviral Particle (Locus ID 361638)
Human Armadillo Repeat Containing 3 (ARMC3) ELISA Kit