Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Collectin-11/CL-K1, Human (HEK293, His)

Collectin-11/CL-K1 is an important lectin in innate immunity, apoptosis, and embryogenesis that recognizes sugars presenting high mannose oligosaccharides with at least one terminal α-1,2-linked mannose epitope protein. It also recognizes fucosylated glycans and lipopolysaccharides. Collectin-11/CL-K1 Protein, Human (HEK293, His) is the recombinant human-derived Collectin-11/CL-K1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Collectin-11/CL-K1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/collectin-11-cl-k1-protein-human-hek-293-his.html

Purity

95.0

Smiles

QPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM

Molecular Formula

78989 (Gene_ID) Q9BWP8 (Q26-M271) (Accession)

Molecular Weight

30-35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant ATP1A3 Antibody
RC-16089-01 50 μL

Recombinant ATP1A3 Antibody

Sign In for Pricing
View Details
Recombinant ATP1A3 Antibody
RC-16089-02 100 µL

Recombinant ATP1A3 Antibody

Sign In for Pricing
View Details
Recombinant ATP1A3 Antibody
RC-16089-03 1 mL

Recombinant ATP1A3 Antibody

Sign In for Pricing
View Details
SAMD4A (NM_001161577) Human Over-expression Lysate
LY431303 100 µg

SAMD4A (NM_001161577) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CLK1 activation kit by CRISPRa
GA100854 1 Kit

Human CLK1 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS806611 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details