Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Siglec-2/CD22, Human (Biotinylated, HEK293, His-Avi)

The Siglec-2/CD22 protein mediates B cell interactions and may direct B cell localization within lymphoid tissues. It recognizes sialylated glycoproteins, especially α-2,6-linked sialic acid, and participates in cis-interactions at the cell surface. Siglec-2/CD22 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived Siglec-2/CD22 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

Siglec-2/CD22 Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd22-protein-human-hek-293-his-avi.html

Smiles

DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRR

Molecular Formula

933 (Gene_ID) P20273 (D20-R687) (Accession)

Molecular Weight

Approximately 110-130 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL
BNC551037-100 1x 100 µL

CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF647 conjugate, 0.1mg/mL
BNC470160-100 1x 100 µL

CD20 (B9E9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
BNC400009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL
BNC470003-500 1x 500 µL

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Moesin (MSN/493), CF740 conjugate, 0.1mg/mL
BNC740493-100 1x 100 µL

Moesin (MSN/493), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2597), CF405S conjugate, 0.1mg/mL
BNC042597-100 1x 100 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2597), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details