Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zea mays Profilin-1 (PRO1)

Product Specifications

Product Name Alternative

Pollen allergen Zea m 12; ZmPRO1; allergen Zea m 12

Abbreviation

Recombinant Zea mays PRO1 protein

Gene Name

PRO1

UniProt

P35081

Expression Region

2-131aa

Organism

Zea mays (Maize)

Target Sequence

SWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVERLGDYLLEQGM

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tau Antibody
KC-16719-01 50 μL

Tau Antibody

Sign In for Pricing
View Details
Tau Antibody
KC-16719-02 100 µL

Tau Antibody

Sign In for Pricing
View Details
Tau Antibody
KC-16719-03 1 mL

Tau Antibody

Sign In for Pricing
View Details
LATS1 Human Gene Knockout Kit (CRISPR)
KN423650 1 Kit

LATS1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TRIM24 Antibody
8C10073-AAT 50 µg

TRIM24 Antibody

Sign In for Pricing
View Details
ANKRD56 (SOWAHB) (NM_001029870) Human Over-expression Lysate
LC422254 20 µg

ANKRD56 (SOWAHB) (NM_001029870) Human Over-expression Lysate

Sign In for Pricing
View Details