Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-7, Human (CHO, His)

IL-7 protein is an important hematopoietic cytokine that is essential for the development, expansion and survival of T cells and B cells, regulating mature lymphocyte populations and maintaining lymphatic homeostasis. IL-7 interacts with IL7RA and CSF2RG subunits, activates kinases, including JAK1 or JAK3, and initiates signaling cascades, such as the PI3K/Akt/mTOR or JAK-STAT5 pathway. IL-7 Protein, Human (CHO, His) is the recombinant human-derived IL-7 protein, expressed by CHO , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-7 Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-7-protein-human-cho-his.html

Purity

95.00

Smiles

DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH

Molecular Formula

3574 (Gene_ID) P13232-1 (D26-H177) (Accession)

Molecular Weight

Approximately 24-30 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal UBE2F/NCE2 Antibody [DyLight 488]
NBP3-00049G 0.1 mL

Rabbit Polyclonal UBE2F/NCE2 Antibody [DyLight 488]

Sign In for Pricing
View Details
Zbtb4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4736307 1.0 µg DNA

Zbtb4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Mouse Ang-II (Angiotensin II) ValidElisa Kit
EK343302 96 Well

Mouse Ang-II (Angiotensin II) ValidElisa Kit

Sign In for Pricing
View Details
Amy2 ORF Vector (Rat) (pORF)
ORF063368 1.0 µg DNA

Amy2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Slc25a24 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6151602 1.0 µg DNA

Slc25a24 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
H4C12 (NM_003541) Human Over-expression Lysate
LC418629 20 µg

H4C12 (NM_003541) Human Over-expression Lysate

Sign In for Pricing
View Details