Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-7, Human (CHO, His)

IL-7 protein is an important hematopoietic cytokine that is essential for the development, expansion and survival of T cells and B cells, regulating mature lymphocyte populations and maintaining lymphatic homeostasis. IL-7 interacts with IL7RA and CSF2RG subunits, activates kinases, including JAK1 or JAK3, and initiates signaling cascades, such as the PI3K/Akt/mTOR or JAK-STAT5 pathway. IL-7 Protein, Human (CHO, His) is the recombinant human-derived IL-7 protein, expressed by CHO , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-7 Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-7-protein-human-cho-his.html

Purity

95.00

Smiles

DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH

Molecular Formula

3574 (Gene_ID) P13232-1 (D26-H177) (Accession)

Molecular Weight

Approximately 24-30 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Tectb siRNA Oligos set (Rat)
46476176 3x 5 nmol

Tectb siRNA Oligos set (Rat)

Ask
View Details
Recombinant Human Transmembrane protein 65 Protein, His-SUMO, Invitro-E.coli-50ug
QP9989-iv-50ug 50ug

Recombinant Human Transmembrane protein 65 Protein, His-SUMO, Invitro-E.coli-50ug

Ask
View Details
Goat Eukaryotic Translation Initiation Factor 4A1 (EIF4A1) ELISA Kit
MBS9390820 Inquire

Goat Eukaryotic Translation Initiation Factor 4A1 (EIF4A1) ELISA Kit

Ask
View Details
BARD1 (BRCA1-associated RING Domain Protein 1, BARD-1) (HRP)
123829-HRP 100 µL

BARD1 (BRCA1-associated RING Domain Protein 1, BARD-1) (HRP)

Ask
View Details
ABHD10 (NM_018394) Human Over-expression Lysate
LY402682 100 µg

ABHD10 (NM_018394) Human Over-expression Lysate

Ask
View Details