Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-7, Human (CHO, His)

IL-7 protein is an important hematopoietic cytokine that is essential for the development, expansion and survival of T cells and B cells, regulating mature lymphocyte populations and maintaining lymphatic homeostasis. IL-7 interacts with IL7RA and CSF2RG subunits, activates kinases, including JAK1 or JAK3, and initiates signaling cascades, such as the PI3K/Akt/mTOR or JAK-STAT5 pathway. IL-7 Protein, Human (CHO, His) is the recombinant human-derived IL-7 protein, expressed by CHO , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-7 Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-7-protein-human-cho-his.html

Purity

95.00

Smiles

DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH

Molecular Formula

3574 (Gene_ID) P13232-1 (D26-H177) (Accession)

Molecular Weight

Approximately 24-30 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

25-OH VD antibody
FNab10834 100 µg

25-OH VD antibody

Ask
View Details
T4S4 Rabbit Polyclonal Antibody (N-term)
E28PB2728 100 µL

T4S4 Rabbit Polyclonal Antibody (N-term)

Ask
View Details
Human EBAG9/Receptor-binding cancer antigen expressed on SiSo cells ELISA Kit
EK00606E 96 Tests

Human EBAG9/Receptor-binding cancer antigen expressed on SiSo cells ELISA Kit

Ask
View Details
Cyb5r1 (NM_001013126) Rat Tagged Lenti ORF Clone
RR208908L4 10 µg

Cyb5r1 (NM_001013126) Rat Tagged Lenti ORF Clone

Ask
View Details
Cat Paired Box Protein Pax-5 (PAX5) ELISA Kit
MBS9909050 Inquire

Cat Paired Box Protein Pax-5 (PAX5) ELISA Kit

Ask
View Details
Recombinant Pongo abelii Cytochrome c oxidase subunit 1 (MT-CO1), partial
MBS1110032-01 1 mg (E-Coli)

Recombinant Pongo abelii Cytochrome c oxidase subunit 1 (MT-CO1), partial

Ask
View Details