Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FABP3, Human (His)

FABP3 Protein, Human (His) is a recombinant FABP3 protein with a His-flag. FABP3 Protein is expressed in the skeletal muscle, heart, brain and brown adipose tissue[1].

Product Specifications

Product Name Alternative

FABP3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fabp3-protein-human-his.html

Purity

98.0

Smiles

VDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA

Molecular Formula

2170 (Gene_ID) P05413 (V2-A133) (Accession)

Molecular Weight

Approximately 15.0 kDa

References & Citations

[1]Seung-Min Lee, et al. FABP3-mediated membrane lipid saturation alters fluidity and induces ER stress in skeletal muscle with aging. Nat Commun. 2020 Nov 9;11 (1) :5661.|[2]Zheng-Zhao Liu, et al. Autophagy receptor OPTN (optineurin) regulates mesenchymal stem cell fate and bone-fat balance during aging by clearing FABP3. Autophagy. 2020 Nov 4;1-17.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tris(2-chloroethyl)phosphate
TRC-T875500-1G 1 g

Tris(2-chloroethyl)phosphate

Sign In for Pricing
View Details
PYCR2 (NM_013328) Human Over-expression Lysate
LY402246 100 µg

PYCR2 (NM_013328) Human Over-expression Lysate

Sign In for Pricing
View Details
Atg10 Mouse Gene Knockout Kit (CRISPR)
KN501726 1 Kit

Atg10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant MAP3K2 Antibody
RC-4644-01 50 μL

Recombinant MAP3K2 Antibody

Sign In for Pricing
View Details
Recombinant MAP3K2 Antibody
RC-4644-02 100 µL

Recombinant MAP3K2 Antibody

Sign In for Pricing
View Details
Recombinant MAP3K2 Antibody
RC-4644-03 1 mL

Recombinant MAP3K2 Antibody

Sign In for Pricing
View Details