Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FABP3, Human (His)

FABP3 Protein, Human (His) is a recombinant FABP3 protein with a His-flag. FABP3 Protein is expressed in the skeletal muscle, heart, brain and brown adipose tissue[1].

Product Specifications

Product Name Alternative

FABP3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fabp3-protein-human-his.html

Purity

98.0

Smiles

VDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA

Molecular Formula

2170 (Gene_ID) P05413 (V2-A133) (Accession)

Molecular Weight

Approximately 15.0 kDa

References & Citations

[1]Seung-Min Lee, et al. FABP3-mediated membrane lipid saturation alters fluidity and induces ER stress in skeletal muscle with aging. Nat Commun. 2020 Nov 9;11 (1) :5661.|[2]Zheng-Zhao Liu, et al. Autophagy receptor OPTN (optineurin) regulates mesenchymal stem cell fate and bone-fat balance during aging by clearing FABP3. Autophagy. 2020 Nov 4;1-17.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYNPR Protein Vector (Rat) (pPB-C-His)
PV309266 500 ng

SYNPR Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Speb Polyclonal Antibody
CAC11043-01 50 µg

Speb Polyclonal Antibody

Sign In for Pricing
View Details
Speb Polyclonal Antibody
CAC11043-02 100 µg

Speb Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Artery: peripheral
CS546534 5x 5 µm

Frozen Tissue Sections, Artery: peripheral

Sign In for Pricing
View Details
MAGEB1 Rabbit Polyclonal Antibody (BF594)
orb2397448 100 µL

MAGEB1 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Phenylbiguanide
orb1220548-01 200 mg

Phenylbiguanide

Sign In for Pricing
View Details