Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLGF-1, Human (N-His)

The PLGF-1 protein is a key growth factor for angiogenesis and endothelial cell growth, crucially stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor. It coordinates the angiogenic process, regulates blood vessel growth, and exhibits additional binding capabilities to NRP1/neuropilin-1 and NRP2/neuropilin-2. PLGF-1 Protein, Human (N-His) is the recombinant human-derived PLGF-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PLGF-1 Protein, Human (N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/plgf-protein-human-n-his.html

Purity

97.00

Smiles

LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRR

Molecular Formula

5228 (Gene_ID) P49763-2 (L19-R149) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chondroitin sulfate
C08545-1g 1 g

Chondroitin sulfate

Sign In for Pricing
View Details
Hsd17b11 Peptide - middle region (AAP40842)
AAP40842-100UG 100 µg

Hsd17b11 Peptide - middle region (AAP40842)

Sign In for Pricing
View Details
Clotrimazole
TRC-C587400-50MG 50 mg

Clotrimazole

Sign In for Pricing
View Details
Lentiviral human SPTLC1 shRNA (UAS) - Lentiviral human SPTLC1 shRNA (UAS) (25)
GTR15311780 1 Vial

Lentiviral human SPTLC1 shRNA (UAS) - Lentiviral human SPTLC1 shRNA (UAS) (25)

Sign In for Pricing
View Details
Mouse OxLDLR (Oxidized Low Density Lipoprotein Receptor) ELISA Kit
EK247912 96 Well

Mouse OxLDLR (Oxidized Low Density Lipoprotein Receptor) ELISA Kit

Sign In for Pricing
View Details
Caprisil C8-IP HPLC Column, 3 µm, 100 Å, CA535-C8-IP x 50 mm
CA335-C8-IP 3 µm

Caprisil C8-IP HPLC Column, 3 µm, 100 Å, CA535-C8-IP x 50 mm

Sign In for Pricing
View Details