Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Apolipoprotein D (Apod)

Product Specifications

Product Name Alternative

Apolipoprotein D (Apo-D) (ApoD)

Abbreviation

Recombinant Mouse Apod protein

Gene Name

Apod

UniProt

P51910

Expression Region

21-189aa

Organism

Mus musculus (Mouse)

Target Sequence

QNFHLGKCPSPPVQENFDVKKYLGRWYEIEKIPASFEKGNCIQANYSLMENGNIEVLNKELSPDGTMNQVKGEAKQSNVSEPAKLEVQFFPLMPPAPYWILATDYENYALVYSCTTFFWLFHVDFVWILGRNPYLPPETITYLKDILTSNGIDIEKMTTTDQANCPDFL

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

APOD occurs in the macromolecular complex with lecithin-transport and binding of bilin. Appears to be able to transport a variety of ligands in a number of different contexts.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.9 kDa

References & Citations

"Expression of somatostatin and somatostatin receptor subtypes in Apolipoprotein D (ApoD) knockout mouse brain: An immunohistochemical analysis." Rajput P.S., Billova S., Patel S.C., Kharmate G., Somvanshi R.K., Kumar U. J Chem Neuroanat 38:20-33 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) FOL1 Polyclonal Antibody
MBS7194982 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) FOL1 Polyclonal Antibody

Sign In for Pricing
View Details
HMGN3 Protein Vector (Rat) (pPB-C-His)
PV273006 500 ng

HMGN3 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Marinobacter aquaeolei Deoxycytidine triphosphate deaminase (dcd)
MBS1178260-01 0.05 mg (E-Coli)

Recombinant Marinobacter aquaeolei Deoxycytidine triphosphate deaminase (dcd)

Sign In for Pricing
View Details
Recombinant Marinobacter aquaeolei Deoxycytidine triphosphate deaminase (dcd)
MBS1178260-02 0.05 mg (Yeast)

Recombinant Marinobacter aquaeolei Deoxycytidine triphosphate deaminase (dcd)

Sign In for Pricing
View Details
Recombinant Marinobacter aquaeolei Deoxycytidine triphosphate deaminase (dcd)
MBS1178260-03 0.2 mg (E-Coli)

Recombinant Marinobacter aquaeolei Deoxycytidine triphosphate deaminase (dcd)

Sign In for Pricing
View Details
Recombinant Marinobacter aquaeolei Deoxycytidine triphosphate deaminase (dcd)
MBS1178260-04 0.5 mg (E-Coli)

Recombinant Marinobacter aquaeolei Deoxycytidine triphosphate deaminase (dcd)

Sign In for Pricing
View Details