Kras4B, Human (G12S, His)
KRAS protein is a key Ras family member that binds GDP/GTP and has intrinsic GTPase activity. Its critical role in regulating cell proliferation emphasizes its importance in cellular processes. Kras4B Protein, Human (G12S, His) is the recombinant human-derived KRAS, expressed by E. coli, with N-6*His labeled tag.
Product Specifications
Product Name Alternative
Kras4B Protein, Human (G12S, His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/kras-protein-human-g12s-his.html
Purity
98.00
Smiles
TEYKLVVVGASGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC
Molecular Formula
3845 (Gene_ID) AAH13572.1 (T2-C185, G12S) (Accession)
Molecular Weight
Approximately 25-30 kDa.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS438038-01 0.02 mg (With BSA & Azide at 0.2mg/mL)
TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) Mouse Monoclonal Antibody
Sign In for Pricing
View Details 
MBS438038-02 0.1 mg (With BSA & Azide at 0.2mg/mL)
TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) Mouse Monoclonal Antibody
Sign In for Pricing
View Details MBS438038-03 0.1 mg (Without BSA & Azide at 1mg/mL)
TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) Mouse Monoclonal Antibody
Sign In for Pricing
View Details 
MBS438038-04 5x 0.1 mg (With BSA & Azide at 0.2mg/mL)
TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) Mouse Monoclonal Antibody
Sign In for Pricing
View Details MBS438038-05 5x 0.1 mg (Without BSA & Azide at 1mg/mL)
TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) Mouse Monoclonal Antibody
Sign In for Pricing
View Details