B7-2/CD86, Cynomolgus/Rhesus Macaque (HEK293, His)
B7-2/CD86 Protein, Cynomolgus/Rhesus Macaque (HEK293, His), a second CTLA4 ligand expressed on murine B cells, can serve as a costimulatory molecule for T cell activation[1][2].
Product Specifications
Product Name Alternative
B7-2/CD86 Protein, Cynomolgus/Rhesus Macaque (HEK293, His), Rhesus Macaque; Cynomolgus, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/b7-2-protein-rhesus-macaque-hek293-his.html
Purity
95.0
Smiles
YFNETADLPCQFANSQNRSLSELVVFWQNQENLVLNEVYLGKEKFDSVHSKYMGRTSFDPESWTLRLHNLQIKDKGLYQCIIHHKRPTGMIRIHQMNSELSVLANFSQPEIVPISNITENMYINLTCSSIHGYPEPEKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCVLETDKTQLLSSPFSIELEDPQPPPDHIPHHHHHH
Molecular Formula
/ (Gene_ID) H9ZFI8 (Y31-P247) (Accession)
Molecular Weight
40-90 kDa
References & Citations
[1]K S Hathcock, et al. Comparative analysis of B7-1 and B7-2 costimulatory ligands: expression and function. J Exp Med. 1994 Aug 1;180 (2) :631-40.|[2]S Tsuyuki, et al. Costimulation through B7-2 (CD86) is required for the induction of a lung mucosal T helper cell 2 (TH2) immune response and altered airway responsiveness. J Exp Med. 1997 May 5;185 (9) :1671-9.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680178-100 1x 100 µL
CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881231-100 1x 100 µL
Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400669-100 1x 100 µL
P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 