B7-2/CD86, Cynomolgus/Rhesus Macaque (HEK293, His)
B7-2/CD86 Protein, Cynomolgus/Rhesus Macaque (HEK293, His), a second CTLA4 ligand expressed on murine B cells, can serve as a costimulatory molecule for T cell activation[1][2].
Product Specifications
Product Name Alternative
B7-2/CD86 Protein, Cynomolgus/Rhesus Macaque (HEK293, His), Rhesus Macaque; Cynomolgus, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/b7-2-protein-rhesus-macaque-hek293-his.html
Purity
95.0
Smiles
YFNETADLPCQFANSQNRSLSELVVFWQNQENLVLNEVYLGKEKFDSVHSKYMGRTSFDPESWTLRLHNLQIKDKGLYQCIIHHKRPTGMIRIHQMNSELSVLANFSQPEIVPISNITENMYINLTCSSIHGYPEPEKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCVLETDKTQLLSSPFSIELEDPQPPPDHIPHHHHHH
Molecular Formula
/ (Gene_ID) H9ZFI8 (Y31-P247) (Accession)
Molecular Weight
40-90 kDa
References & Citations
[1]K S Hathcock, et al. Comparative analysis of B7-1 and B7-2 costimulatory ligands: expression and function. J Exp Med. 1994 Aug 1;180 (2) :631-40.|[2]S Tsuyuki, et al. Costimulation through B7-2 (CD86) is required for the induction of a lung mucosal T helper cell 2 (TH2) immune response and altered airway responsiveness. J Exp Med. 1997 May 5;185 (9) :1671-9.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
168723-01 20 µg
CD86 (Activation B7-2 antigen, B lymphocyte activation antigen B72, CD28 antigen ligand 2, CD28LG2, CLS1, CTLA-4 counter-receptor B7.2, Early T-cell costimulatory molecule 1, ETC-1, FUN-1, LAB72, Ly-58, MB7-2, TS/A-2) discontinued
Sign In for Pricing
View Details 168723-02 100 µg
CD86 (Activation B7-2 antigen, B lymphocyte activation antigen B72, CD28 antigen ligand 2, CD28LG2, CLS1, CTLA-4 counter-receptor B7.2, Early T-cell costimulatory molecule 1, ETC-1, FUN-1, LAB72, Ly-58, MB7-2, TS/A-2) discontinued
Sign In for Pricing
View Details 
SERPINB1B-8052M 50 µg
Recombinant Mouse SERPINB1B Protein, His (Fc)-Avi-tagged
Sign In for Pricing
View Details