Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP14, Human (His)

USP14 is a proteasome-associated deubiquitinase that regulates ubiquitin dynamics by releasing ubiquitin from proteins marked for degradation. As a reversible proteasome subunit, USP14 ensures ubiquitin replenishment. USP14 Protein, Human (His) is the recombinant human-derived USP14 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

USP14 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/usp14-protein-human-his.html

Purity

94.00

Smiles

DMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ

Molecular Formula

9097 (Gene_ID) P54578-1 (D91-Q494) (Accession)

Molecular Weight

47-52 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp157 3'UTR Luciferase Stable Cell Line
TU223662 1.0 mL

Zfp157 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human Serpin A11 (SERPINA11) ELISA Kit
MBS2804988-01 48 Tests

Human Serpin A11 (SERPINA11) ELISA Kit

Sign In for Pricing
View Details
Human Serpin A11 (SERPINA11) ELISA Kit
MBS2804988-02 96 Tests

Human Serpin A11 (SERPINA11) ELISA Kit

Sign In for Pricing
View Details
Human Serpin A11 (SERPINA11) ELISA Kit
MBS2804988-03 5x 96 Tests

Human Serpin A11 (SERPINA11) ELISA Kit

Sign In for Pricing
View Details
Human Serpin A11 (SERPINA11) ELISA Kit
MBS2804988-04 10x 96 Tests

Human Serpin A11 (SERPINA11) ELISA Kit

Sign In for Pricing
View Details
FY5000 DNA Marker
EG21911M 5x 250 µL

FY5000 DNA Marker

Sign In for Pricing
View Details