Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP14, Human (His)

USP14 is a proteasome-associated deubiquitinase that regulates ubiquitin dynamics by releasing ubiquitin from proteins marked for degradation. As a reversible proteasome subunit, USP14 ensures ubiquitin replenishment. USP14 Protein, Human (His) is the recombinant human-derived USP14 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

USP14 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/usp14-protein-human-his.html

Purity

94.00

Smiles

DMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ

Molecular Formula

9097 (Gene_ID) P54578-1 (D91-Q494) (Accession)

Molecular Weight

47-52 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFAF1 Antibody
orb2809477 100 µL

NDUFAF1 Antibody

Sign In for Pricing
View Details
HDGF Rabbit Polyclonal Antibody
TA361936 100 µL

HDGF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ETS1 (NM_005238) Human Over-expression Lysate
LY401606 100 µg

ETS1 (NM_005238) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CPEB1 activation kit by CRISPRa
GA112087 1 Kit

Human CPEB1 activation kit by CRISPRa

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) THIG Polyclonal Antibody
MBS7156216 Inquire

Rabbit anti-Escherichia coli (strain K12) THIG Polyclonal Antibody

Sign In for Pricing
View Details
hsa-let-7f miRNA Antagomir
MNH01016 2x 5.0 nmol

hsa-let-7f miRNA Antagomir

Sign In for Pricing
View Details