Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP14, Human (His)

USP14 is a proteasome-associated deubiquitinase that regulates ubiquitin dynamics by releasing ubiquitin from proteins marked for degradation. As a reversible proteasome subunit, USP14 ensures ubiquitin replenishment. USP14 Protein, Human (His) is the recombinant human-derived USP14 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

USP14 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/usp14-protein-human-his.html

Purity

94.00

Smiles

DMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ

Molecular Formula

9097 (Gene_ID) P54578-1 (D91-Q494) (Accession)

Molecular Weight

47-52 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal eIF5A2 Antibody
NBP2-96987-100ul 100 µL

Rabbit Polyclonal eIF5A2 Antibody

Sign In for Pricing
View Details
Human Melanocortin receptor 4 ELISA Kit
orb1660389 96 Tests

Human Melanocortin receptor 4 ELISA Kit

Sign In for Pricing
View Details
Human SLC50A1 shRNA Plasmid
abx961032-01 150 µg

Human SLC50A1 shRNA Plasmid

Sign In for Pricing
View Details
Human SLC50A1 shRNA Plasmid
abx961032-02 300 µg

Human SLC50A1 shRNA Plasmid

Sign In for Pricing
View Details
IQCK Polyclonal Antibody, Cy7 Conjugated
bs-9023R-Cy7 100 µL

IQCK Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Mouse PKCe Matched Antibody Pair Set [ABP-S-052294]
ABP-S-052294 5 Plates

Mouse PKCe Matched Antibody Pair Set [ABP-S-052294]

Sign In for Pricing
View Details