Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Type-1A pilin/fimA, E.coli (His-SUMO)

Type 1A pilins, also known as fimA proteins, promote bacterial colonization by forming pili, or fimbriae (polar filaments extending from the surface of bacteria, reaching 0.5-1.5 microns in length and 100-300 per cell) . These pili play a crucial role in promoting bacterial adhesion to the epithelium of specific host organs. Type-1A pilin/fimA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Type-1A pilin/fimA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Type-1A pilin/fimA Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/type-1a-pilin-fima-protein-e-coli-his-sumo.html

Smiles

AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ

Molecular Formula

948838 (Gene_ID) P04128 (A24-Q182) (Accession)

Molecular Weight

Approximately 31.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

METTL25B Human qPCR Primer Pair (NM_015997)
HP211904 200 Reactions

METTL25B Human qPCR Primer Pair (NM_015997)

Sign In for Pricing
View Details
Mouse Anti-Mouse, Human alpha TubuLin Monoclonal Antibody (EX044) [AF488]
EXA-0822-X185 100 µL

Mouse Anti-Mouse, Human alpha TubuLin Monoclonal Antibody (EX044) [AF488]

Sign In for Pricing
View Details
Lentiviral human SLC30A10 sgRNA gene knockout kit - Lentiviral human SLC30A10 sgRNA gene knockout kit (100)
GTR15375826 1 Vial

Lentiviral human SLC30A10 sgRNA gene knockout kit - Lentiviral human SLC30A10 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Recombinant Human IDO1 Protein, His (Fc)-Avi-tagged
IDO1-1138H 50 µg

Recombinant Human IDO1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Anti-BAFF (Rabbit, Monoclonal, Rabbit IgG)
A101078 100 µL

Anti-BAFF (Rabbit, Monoclonal, Rabbit IgG)

Sign In for Pricing
View Details
1,2,3,4,5-Penta-O-acetyl-b-D-fructose
GC6653-5g 5 g

1,2,3,4,5-Penta-O-acetyl-b-D-fructose

Sign In for Pricing
View Details