Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Type-1A pilin/fimA, E.coli (His-SUMO)

Type 1A pilins, also known as fimA proteins, promote bacterial colonization by forming pili, or fimbriae (polar filaments extending from the surface of bacteria, reaching 0.5-1.5 microns in length and 100-300 per cell) . These pili play a crucial role in promoting bacterial adhesion to the epithelium of specific host organs. Type-1A pilin/fimA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Type-1A pilin/fimA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Type-1A pilin/fimA Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/type-1a-pilin-fima-protein-e-coli-his-sumo.html

Smiles

AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ

Molecular Formula

948838 (Gene_ID) P04128 (A24-Q182) (Accession)

Molecular Weight

Approximately 31.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-ZNF449 antibody
SL12236R-01 50 µL

Rabbit Anti-ZNF449 antibody

Sign In for Pricing
View Details
Rabbit Anti-ZNF449 antibody
SL12236R-02 100 µL

Rabbit Anti-ZNF449 antibody

Sign In for Pricing
View Details
CD25 (Tac antigen, p55, Interleukin 2 Receptor alpha, IL2Ra, T Cell Growth Factor Receptor) (APC)
MBS6258232-01 0.1 mL

CD25 (Tac antigen, p55, Interleukin 2 Receptor alpha, IL2Ra, T Cell Growth Factor Receptor) (APC)

Sign In for Pricing
View Details
CD25 (Tac antigen, p55, Interleukin 2 Receptor alpha, IL2Ra, T Cell Growth Factor Receptor) (APC)
MBS6258232-02 5x 0.1 mL

CD25 (Tac antigen, p55, Interleukin 2 Receptor alpha, IL2Ra, T Cell Growth Factor Receptor) (APC)

Sign In for Pricing
View Details
Rat SRC ELISA Kit
E098791 1 Each

Rat SRC ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal CSE1L/CAS/Exportin-2 Antibody (1E4.)
H00001434-M02 0.1 mg

Mouse Monoclonal CSE1L/CAS/Exportin-2 Antibody (1E4.)

Sign In for Pricing
View Details