Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Type-1A pilin/fimA, E.coli (His-SUMO)

Type 1A pilins, also known as fimA proteins, promote bacterial colonization by forming pili, or fimbriae (polar filaments extending from the surface of bacteria, reaching 0.5-1.5 microns in length and 100-300 per cell) . These pili play a crucial role in promoting bacterial adhesion to the epithelium of specific host organs. Type-1A pilin/fimA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Type-1A pilin/fimA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Type-1A pilin/fimA Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/type-1a-pilin-fima-protein-e-coli-his-sumo.html

Smiles

AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ

Molecular Formula

948838 (Gene_ID) P04128 (A24-Q182) (Accession)

Molecular Weight

Approximately 31.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

General 5-Hydroxytryptamine (5-HT) ELISA Kit
RDR-5-HT-Ge-48Tests 48 Tests

General 5-Hydroxytryptamine (5-HT) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal TOP2A Antibody (TOP2A/4397R) - Azide and BSA Free
NBP3-08756 100 µg

Rabbit Monoclonal TOP2A Antibody (TOP2A/4397R) - Azide and BSA Free

Sign In for Pricing
View Details
Mouse PPM1J shRNA Plasmid
abx977562-01 150 µg

Mouse PPM1J shRNA Plasmid

Sign In for Pricing
View Details
Mouse PPM1J shRNA Plasmid
abx977562-02 300 µg

Mouse PPM1J shRNA Plasmid

Sign In for Pricing
View Details
FluorViolet 610 Rat IgG2b, kappa Isotype Control [LTF-2]
MBS2579355-01 0.025 mg

FluorViolet 610 Rat IgG2b, kappa Isotype Control [LTF-2]

Sign In for Pricing
View Details
FluorViolet 610 Rat IgG2b, kappa Isotype Control [LTF-2]
MBS2579355-02 0.1 mg

FluorViolet 610 Rat IgG2b, kappa Isotype Control [LTF-2]

Sign In for Pricing
View Details