Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Type-1A pilin/fimA, E.coli (His-SUMO)

Type 1A pilins, also known as fimA proteins, promote bacterial colonization by forming pili, or fimbriae (polar filaments extending from the surface of bacteria, reaching 0.5-1.5 microns in length and 100-300 per cell) . These pili play a crucial role in promoting bacterial adhesion to the epithelium of specific host organs. Type-1A pilin/fimA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Type-1A pilin/fimA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Type-1A pilin/fimA Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/type-1a-pilin-fima-protein-e-coli-his-sumo.html

Smiles

AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ

Molecular Formula

948838 (Gene_ID) P04128 (A24-Q182) (Accession)

Molecular Weight

Approximately 31.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r36 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
49661064 1.0 µg DNA

Vmn1r36 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
pLV3-U6-PLIN5-shRNA2-Puro Plasmid
PVT60685 2 µg

pLV3-U6-PLIN5-shRNA2-Puro Plasmid

Sign In for Pricing
View Details
Foxs1 Mouse qPCR Primer Pair (NM_010226)
MP204959 200 Reactions

Foxs1 Mouse qPCR Primer Pair (NM_010226)

Sign In for Pricing
View Details
Human CCL2/MCP-1 Antibody , PerCP
E55A09255 50 Tests

Human CCL2/MCP-1 Antibody , PerCP

Sign In for Pricing
View Details
Eukaryotic Interleukin 3 (IL3), Recombinant, Rat, His-Tag
057621-01 10 µg

Eukaryotic Interleukin 3 (IL3), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details
Eukaryotic Interleukin 3 (IL3), Recombinant, Rat, His-Tag
057621-02 50 µg

Eukaryotic Interleukin 3 (IL3), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details