Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Type-1A pilin/fimA, E.coli (His-SUMO)

Type 1A pilins, also known as fimA proteins, promote bacterial colonization by forming pili, or fimbriae (polar filaments extending from the surface of bacteria, reaching 0.5-1.5 microns in length and 100-300 per cell) . These pili play a crucial role in promoting bacterial adhesion to the epithelium of specific host organs. Type-1A pilin/fimA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Type-1A pilin/fimA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Type-1A pilin/fimA Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/type-1a-pilin-fima-protein-e-coli-his-sumo.html

Smiles

AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ

Molecular Formula

948838 (Gene_ID) P04128 (A24-Q182) (Accession)

Molecular Weight

Approximately 31.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd5 (NM_007650) Mouse Untagged Clone
MC216769 10 µg

Cd5 (NM_007650) Mouse Untagged Clone

Sign In for Pricing
View Details
GAS2-Like Protein 1 (GAS2L1) Antibody
abx001755-01 20 µL

GAS2-Like Protein 1 (GAS2L1) Antibody

Sign In for Pricing
View Details
GAS2-Like Protein 1 (GAS2L1) Antibody
abx001755-02 100 µL

GAS2-Like Protein 1 (GAS2L1) Antibody

Sign In for Pricing
View Details
GAS2-Like Protein 1 (GAS2L1) Antibody
abx001755-03 2x 100 µL

GAS2-Like Protein 1 (GAS2L1) Antibody

Sign In for Pricing
View Details
USP5 Protein Lysate (Human) with C-Ha Tag
49335031 100 µg

USP5 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Mouse Sca-1/Ly6 Alexa Fluor 350 Antibody (Clone 177228)
FAB1226U-100UG 100 µg

Mouse Sca-1/Ly6 Alexa Fluor 350 Antibody (Clone 177228)

Sign In for Pricing
View Details