Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Type-1A pilin/fimA, E.coli (His-SUMO)

Type 1A pilins, also known as fimA proteins, promote bacterial colonization by forming pili, or fimbriae (polar filaments extending from the surface of bacteria, reaching 0.5-1.5 microns in length and 100-300 per cell) . These pili play a crucial role in promoting bacterial adhesion to the epithelium of specific host organs. Type-1A pilin/fimA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Type-1A pilin/fimA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Type-1A pilin/fimA Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/type-1a-pilin-fima-protein-e-coli-his-sumo.html

Smiles

AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ

Molecular Formula

948838 (Gene_ID) P04128 (A24-Q182) (Accession)

Molecular Weight

Approximately 31.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD221 (Insulin-like growth factor I Receptor, IGF-I Receptor) (PE)
C2548-97A-PE 100 µL

CD221 (Insulin-like growth factor I Receptor, IGF-I Receptor) (PE)

Sign In for Pricing
View Details
EGR3 Antibody
ABD8817 100 µg

EGR3 Antibody

Sign In for Pricing
View Details
FSGS1 sgRNA CRISPR Lentivector (Human) (Target 1)
K0816402 1.0 µg DNA

FSGS1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
EB3/MAPRE3 Rabbit mAb (AMR11731N)
AMR11731N-01 50 µL

EB3/MAPRE3 Rabbit mAb (AMR11731N)

Sign In for Pricing
View Details
EB3/MAPRE3 Rabbit mAb (AMR11731N)
AMR11731N-02 100 µL

EB3/MAPRE3 Rabbit mAb (AMR11731N)

Sign In for Pricing
View Details
EB3/MAPRE3 Rabbit mAb (AMR11731N)
AMR11731N-03 200 µL

EB3/MAPRE3 Rabbit mAb (AMR11731N)

Sign In for Pricing
View Details