Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Type-1A pilin/fimA, E.coli (His-SUMO)

Type 1A pilins, also known as fimA proteins, promote bacterial colonization by forming pili, or fimbriae (polar filaments extending from the surface of bacteria, reaching 0.5-1.5 microns in length and 100-300 per cell) . These pili play a crucial role in promoting bacterial adhesion to the epithelium of specific host organs. Type-1A pilin/fimA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Type-1A pilin/fimA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Type-1A pilin/fimA Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/type-1a-pilin-fima-protein-e-coli-his-sumo.html

Smiles

AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ

Molecular Formula

948838 (Gene_ID) P04128 (A24-Q182) (Accession)

Molecular Weight

Approximately 31.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATXN7L1 (Ataxin-7-like Protein 1, Ataxin-7-like Protein 4, ATXN7L4, KIAA1218, MGC10760, MGC33190) (MaxLight 750) discontinued
123756-ML750 100 µL

ATXN7L1 (Ataxin-7-like Protein 1, Ataxin-7-like Protein 4, ATXN7L4, KIAA1218, MGC10760, MGC33190) (MaxLight 750) discontinued

Sign In for Pricing
View Details
ACTN4 (Actinin, alpha 4, ActinIN-4, DKFZp686K23158, FSGS, FSGS1) (AP) discontinued
243069-AP 100 µL

ACTN4 (Actinin, alpha 4, ActinIN-4, DKFZp686K23158, FSGS, FSGS1) (AP) discontinued

Sign In for Pricing
View Details
KRT18P37 sgRNA CRISPR Lentivector (Human) (Target 3)
K1173804 1.0 µg DNA

KRT18P37 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Kcnj11, NT (Kcnj11, ATP-sensitive inward rectifier potassium channel 11, Inward rectifier K(+) channel Kir6.2, Potassium channel, inwardly rectifying subfamily J member 11) (MaxLight 405)
MBS6312516-01 0.1 mL

Kcnj11, NT (Kcnj11, ATP-sensitive inward rectifier potassium channel 11, Inward rectifier K(+) channel Kir6.2, Potassium channel, inwardly rectifying subfamily J member 11) (MaxLight 405)

Sign In for Pricing
View Details
Kcnj11, NT (Kcnj11, ATP-sensitive inward rectifier potassium channel 11, Inward rectifier K(+) channel Kir6.2, Potassium channel, inwardly rectifying subfamily J member 11) (MaxLight 405)
MBS6312516-02 5x 0.1 mL

Kcnj11, NT (Kcnj11, ATP-sensitive inward rectifier potassium channel 11, Inward rectifier K(+) channel Kir6.2, Potassium channel, inwardly rectifying subfamily J member 11) (MaxLight 405)

Sign In for Pricing
View Details
RGD1563015 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6527205 3x 1.0 µg

RGD1563015 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details