Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Type-1A pilin/fimA, E.coli (His-SUMO)

Type 1A pilins, also known as fimA proteins, promote bacterial colonization by forming pili, or fimbriae (polar filaments extending from the surface of bacteria, reaching 0.5-1.5 microns in length and 100-300 per cell) . These pili play a crucial role in promoting bacterial adhesion to the epithelium of specific host organs. Type-1A pilin/fimA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Type-1A pilin/fimA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Type-1A pilin/fimA Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/type-1a-pilin-fima-protein-e-coli-his-sumo.html

Smiles

AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ

Molecular Formula

948838 (Gene_ID) P04128 (A24-Q182) (Accession)

Molecular Weight

Approximately 31.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Casein Kinase 2 beta Active
7-03892 3 µg

Recombinant Human Casein Kinase 2 beta Active

Sign In for Pricing
View Details
BCAM/CD239 Recombinant Protein Antigen
NBP2-31994PEP 0.1 mL

BCAM/CD239 Recombinant Protein Antigen

Sign In for Pricing
View Details
APRIL (TNFSF13) (NM_003808) Human Over-expression Lysate
LC401250 20 µg

APRIL (TNFSF13) (NM_003808) Human Over-expression Lysate

Sign In for Pricing
View Details
Rat Claudin 3 (CLDN3) ELISA kit
GA-E0895RT-01 48 Tests

Rat Claudin 3 (CLDN3) ELISA kit

Sign In for Pricing
View Details
Rat Claudin 3 (CLDN3) ELISA kit
GA-E0895RT-02 96 Tests

Rat Claudin 3 (CLDN3) ELISA kit

Sign In for Pricing
View Details
Human GAP43 (Growth Associated Protein 43) ELISA Kit
MBS8800885-01 48 Well

Human GAP43 (Growth Associated Protein 43) ELISA Kit

Sign In for Pricing
View Details