Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Type-1A pilin/fimA, E.coli (His-SUMO)

Type 1A pilins, also known as fimA proteins, promote bacterial colonization by forming pili, or fimbriae (polar filaments extending from the surface of bacteria, reaching 0.5-1.5 microns in length and 100-300 per cell) . These pili play a crucial role in promoting bacterial adhesion to the epithelium of specific host organs. Type-1A pilin/fimA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Type-1A pilin/fimA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Type-1A pilin/fimA Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/type-1a-pilin-fima-protein-e-coli-his-sumo.html

Smiles

AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ

Molecular Formula

948838 (Gene_ID) P04128 (A24-Q182) (Accession)

Molecular Weight

Approximately 31.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal p16INK4a/CDKN2A Antibody (CDKN2A/7081R) [DyLight 594]
NBP3-14227DL594 0.1 mL

Rabbit Monoclonal p16INK4a/CDKN2A Antibody (CDKN2A/7081R) [DyLight 594]

Sign In for Pricing
View Details
Gabazine Ethyl Ester
MBS6014061-01 25 mg

Gabazine Ethyl Ester

Sign In for Pricing
View Details
Gabazine Ethyl Ester
MBS6014061-02 5x 25 mg

Gabazine Ethyl Ester

Sign In for Pricing
View Details
YWHAG Antibody
A53698-100UL 100 µL

YWHAG Antibody

Sign In for Pricing
View Details
Human CRYBA4 knockout cell line
ABC-KH3596 1 Vial

Human CRYBA4 knockout cell line

Sign In for Pricing
View Details
Lentiviral mouse Plpp4 shRNA (UAS) - Lentiviral mouse Plpp4 shRNA (UAS) (25)
GTR15222053 1 Vial

Lentiviral mouse Plpp4 shRNA (UAS) - Lentiviral mouse Plpp4 shRNA (UAS) (25)

Sign In for Pricing
View Details