Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Type-1A pilin/fimA, E.coli (His-SUMO)

Type 1A pilins, also known as fimA proteins, promote bacterial colonization by forming pili, or fimbriae (polar filaments extending from the surface of bacteria, reaching 0.5-1.5 microns in length and 100-300 per cell) . These pili play a crucial role in promoting bacterial adhesion to the epithelium of specific host organs. Type-1A pilin/fimA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Type-1A pilin/fimA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Type-1A pilin/fimA Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/type-1a-pilin-fima-protein-e-coli-his-sumo.html

Smiles

AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ

Molecular Formula

948838 (Gene_ID) P04128 (A24-Q182) (Accession)

Molecular Weight

Approximately 31.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNU6-44 sgRNA CRISPR Lentivector (Human) (Target 1)
K1853302 1.0 µg DNA

RNU6-44 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
ZNF860 Double Nickase Plasmid (h2)
sc-418042-NIC-2 20 µg

ZNF860 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Mouse Btbd1 Pre-designed siRNA Set A
SI101582A 1 Each

Mouse Btbd1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
MARK2 (MAP/microtubule Affinity-regulating Kinase 2, ELKL Motif Kinase 1, EMK1, EMK-1, PAR1 Homolog, PAR1 Homolog b, Par1b, Par-1b, PAR-1, Serine/threonine-protein Kinase MARK2) (AP) discontinued
129436-AP 100 µL

MARK2 (MAP/microtubule Affinity-regulating Kinase 2, ELKL Motif Kinase 1, EMK1, EMK-1, PAR1 Homolog, PAR1 Homolog b, Par1b, Par-1b, PAR-1, Serine/threonine-protein Kinase MARK2) (AP) discontinued

Sign In for Pricing
View Details
CART1 (ALX Homeobox Protein 1, Cartilage Homeoprotein 1, CART-1, ALX1) (MaxLight 405) discontinued
124350-ML405 100 µL

CART1 (ALX Homeobox Protein 1, Cartilage Homeoprotein 1, CART-1, ALX1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Human TAL1 Protein Lysate
MBS8428217-01 0.02 mg

Human TAL1 Protein Lysate

Sign In for Pricing
View Details