Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Type-1A pilin/fimA, E.coli (His-SUMO)

Type 1A pilins, also known as fimA proteins, promote bacterial colonization by forming pili, or fimbriae (polar filaments extending from the surface of bacteria, reaching 0.5-1.5 microns in length and 100-300 per cell) . These pili play a crucial role in promoting bacterial adhesion to the epithelium of specific host organs. Type-1A pilin/fimA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Type-1A pilin/fimA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Type-1A pilin/fimA Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/type-1a-pilin-fima-protein-e-coli-his-sumo.html

Smiles

AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ

Molecular Formula

948838 (Gene_ID) P04128 (A24-Q182) (Accession)

Molecular Weight

Approximately 31.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNRPN (NM_003097) Human Over-expression Lysate
LH19290V 100 µg

SNRPN (NM_003097) Human Over-expression Lysate

Sign In for Pricing
View Details
GIT2 Antibody, FITC conjugated
A54160-50UG 50 µg

GIT2 Antibody, FITC conjugated

Sign In for Pricing
View Details
IL13 (Interleukin 13, ALRH, BHR1, IL-13, MGC116786, MGC116788, MGC116789, P600) (PE)
MBS6184553-01 0.1 mL

IL13 (Interleukin 13, ALRH, BHR1, IL-13, MGC116786, MGC116788, MGC116789, P600) (PE)

Sign In for Pricing
View Details
IL13 (Interleukin 13, ALRH, BHR1, IL-13, MGC116786, MGC116788, MGC116789, P600) (PE)
MBS6184553-02 5x 0.1 mL

IL13 (Interleukin 13, ALRH, BHR1, IL-13, MGC116786, MGC116788, MGC116789, P600) (PE)

Sign In for Pricing
View Details
MUC1/EMA, CT (MUC1, PUM, Mucin-1, Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, Episialin, H23AG, Krebs von den Lungen-6, PEMT, Peanut-reactive urinary mucin, Polymorphic epithelial mucin, Tumor-associated epithelial membrane antigen, Tumor-associated mucin, CD227, Mucin-1 subunit alpha, Mucin-1 subunit beta, MUC1-CT) (AP) discontinued
038691-AP 200 µL

MUC1/EMA, CT (MUC1, PUM, Mucin-1, Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, Episialin, H23AG, Krebs von den Lungen-6, PEMT, Peanut-reactive urinary mucin, Polymorphic epithelial mucin, Tumor-associated epithelial membrane antigen, Tumor-associated mucin, CD227, Mucin-1 subunit alpha, Mucin-1 subunit beta, MUC1-CT) (AP) discontinued

Sign In for Pricing
View Details
GTF3C3 (General Transcription Factor IIIC, Polypeptide 3, 102kD, TFIIIC102, TFIIICgamma, TFiiiC2-102) (HRP)
MBS6179465-01 0.1 mL

GTF3C3 (General Transcription Factor IIIC, Polypeptide 3, 102kD, TFIIIC102, TFIIICgamma, TFiiiC2-102) (HRP)

Sign In for Pricing
View Details