Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFG-E8, Mouse (HEK293, His)

The MFG-E8 protein plays a critical role in promoting the phagocytic clearance of apoptotic cells in various tissues.As a specific ligand, it interacts with alpha-v/beta-3 and alpha-v/beta-5 receptors and also binds independently to phosphatidylserine-rich cell surfaces.MFG-E8 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MFG-E8 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

MFG-E8 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mfg-e8-protein-mouse-hek293-his.html

Purity

97.0

Smiles

ASGDFCDSSLCLNGGTCLTGQDNDIYCLCPEGFTGLVCNETERGPCSPNPCYNDAKCLVTLDTQRGDIFTEYICQCPVGYSGIHCETETNYYNLDGEYMFTTAVPNTAVPTPAPTPDLSNNLASRCSTQLGMEGGAIADSQISASSVYMGFMGLQRWGPELARLYRTGIVNAWTASNYDSKPWIQVNLLRKMRVSGVMTQGASRAGRAEYLKTFKVAYSLDGRKFEFIQDESGGDKEFLGNLDNNSLKVNMFNPTLEAQYIKLYPVSCHRGCTLRFELLGCELHGCSEPLGLKNNTIPDSQMSASSSYKTWNLRAFGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQRQVTGIITQGARDFGHIQYVASYKVAHSDDGVQWTVYEEQGSSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPVSWHNRITLRLELLGC

Molecular Formula

17304 (Gene_ID) P21956 (A23-C463) (Accession)

Molecular Weight

Approximately 60-75 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBOAT7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
28183111 3x 1.0 µg

MBOAT7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
CASP6 antibody - middle region
MBS3214147-01 0.1 mL

CASP6 antibody - middle region

Sign In for Pricing
View Details
CASP6 antibody - middle region
MBS3214147-02 5x 0.1 mL

CASP6 antibody - middle region

Sign In for Pricing
View Details
Recombinant Francisella philomiragia subsp. philomiragia Lon protease (lon), partial
MBS1067834 Inquire

Recombinant Francisella philomiragia subsp. philomiragia Lon protease (lon), partial

Sign In for Pricing
View Details
CHFR Antibody, FITC conjugated
CSB-PA839315LC01HU-01 50 µg

CHFR Antibody, FITC conjugated

Sign In for Pricing
View Details
CHFR Antibody, FITC conjugated
CSB-PA839315LC01HU-02 100 µg

CHFR Antibody, FITC conjugated

Sign In for Pricing
View Details