Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFG-E8, Mouse (HEK293, His)

The MFG-E8 protein plays a critical role in promoting the phagocytic clearance of apoptotic cells in various tissues.As a specific ligand, it interacts with alpha-v/beta-3 and alpha-v/beta-5 receptors and also binds independently to phosphatidylserine-rich cell surfaces.MFG-E8 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MFG-E8 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

MFG-E8 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mfg-e8-protein-mouse-hek293-his.html

Purity

97.0

Smiles

ASGDFCDSSLCLNGGTCLTGQDNDIYCLCPEGFTGLVCNETERGPCSPNPCYNDAKCLVTLDTQRGDIFTEYICQCPVGYSGIHCETETNYYNLDGEYMFTTAVPNTAVPTPAPTPDLSNNLASRCSTQLGMEGGAIADSQISASSVYMGFMGLQRWGPELARLYRTGIVNAWTASNYDSKPWIQVNLLRKMRVSGVMTQGASRAGRAEYLKTFKVAYSLDGRKFEFIQDESGGDKEFLGNLDNNSLKVNMFNPTLEAQYIKLYPVSCHRGCTLRFELLGCELHGCSEPLGLKNNTIPDSQMSASSSYKTWNLRAFGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQRQVTGIITQGARDFGHIQYVASYKVAHSDDGVQWTVYEEQGSSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPVSWHNRITLRLELLGC

Molecular Formula

17304 (Gene_ID) P21956 (A23-C463) (Accession)

Molecular Weight

Approximately 60-75 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

mmu-miR-7034-3p Primers
MPM01890 150 µL / 10 µM

mmu-miR-7034-3p Primers

Sign In for Pricing
View Details
CDC25C Antibody (Phospho-Ser198)
OASG01404-100UL 100 µL

CDC25C Antibody (Phospho-Ser198)

Sign In for Pricing
View Details
Rabbit Monoclonal B7-1/CD80 Antibody (16C10) [DyLight 755]
NBP3-12027IR 0.1 mL

Rabbit Monoclonal B7-1/CD80 Antibody (16C10) [DyLight 755]

Sign In for Pricing
View Details
Mouse Dectin-2/CLEC6A MAb (Clone 217611)
MAB1525-SP 25 µg

Mouse Dectin-2/CLEC6A MAb (Clone 217611)

Sign In for Pricing
View Details
Rpl17 (NM_001002239) Mouse Tagged ORF Clone Lentiviral Particle
MR201705L4V 200 µL

Rpl17 (NM_001002239) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-AChE Q Antibody
CPA3504-01 30 µL

Anti-AChE Q Antibody

Sign In for Pricing
View Details