Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFG-E8, Mouse (HEK293, His)

The MFG-E8 protein plays a critical role in promoting the phagocytic clearance of apoptotic cells in various tissues.As a specific ligand, it interacts with alpha-v/beta-3 and alpha-v/beta-5 receptors and also binds independently to phosphatidylserine-rich cell surfaces.MFG-E8 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MFG-E8 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

MFG-E8 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mfg-e8-protein-mouse-hek293-his.html

Purity

97.0

Smiles

ASGDFCDSSLCLNGGTCLTGQDNDIYCLCPEGFTGLVCNETERGPCSPNPCYNDAKCLVTLDTQRGDIFTEYICQCPVGYSGIHCETETNYYNLDGEYMFTTAVPNTAVPTPAPTPDLSNNLASRCSTQLGMEGGAIADSQISASSVYMGFMGLQRWGPELARLYRTGIVNAWTASNYDSKPWIQVNLLRKMRVSGVMTQGASRAGRAEYLKTFKVAYSLDGRKFEFIQDESGGDKEFLGNLDNNSLKVNMFNPTLEAQYIKLYPVSCHRGCTLRFELLGCELHGCSEPLGLKNNTIPDSQMSASSSYKTWNLRAFGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQRQVTGIITQGARDFGHIQYVASYKVAHSDDGVQWTVYEEQGSSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPVSWHNRITLRLELLGC

Molecular Formula

17304 (Gene_ID) P21956 (A23-C463) (Accession)

Molecular Weight

Approximately 60-75 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG4D Peptide
orb1231820 0.05 mg

ATG4D Peptide

Sign In for Pricing
View Details
Lomefloxacin hydrochloride
orb1223486-01 1 g

Lomefloxacin hydrochloride

Sign In for Pricing
View Details
Lomefloxacin hydrochloride
orb1223486-02 100 mg

Lomefloxacin hydrochloride

Sign In for Pricing
View Details
Lomefloxacin hydrochloride
orb1223486-03 500 mg

Lomefloxacin hydrochloride

Sign In for Pricing
View Details
Prl7a1-set siRNA/shRNA/RNAi Lentivector (Mouse)
37692094 4x 500 ng

Prl7a1-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Polyclonal Antibody to CD11C
MBS668584-01 0.025 mg

Polyclonal Antibody to CD11C

Sign In for Pricing
View Details