Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFG-E8, Mouse (HEK293, His)

The MFG-E8 protein plays a critical role in promoting the phagocytic clearance of apoptotic cells in various tissues.As a specific ligand, it interacts with alpha-v/beta-3 and alpha-v/beta-5 receptors and also binds independently to phosphatidylserine-rich cell surfaces.MFG-E8 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MFG-E8 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

MFG-E8 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mfg-e8-protein-mouse-hek293-his.html

Purity

97.0

Smiles

ASGDFCDSSLCLNGGTCLTGQDNDIYCLCPEGFTGLVCNETERGPCSPNPCYNDAKCLVTLDTQRGDIFTEYICQCPVGYSGIHCETETNYYNLDGEYMFTTAVPNTAVPTPAPTPDLSNNLASRCSTQLGMEGGAIADSQISASSVYMGFMGLQRWGPELARLYRTGIVNAWTASNYDSKPWIQVNLLRKMRVSGVMTQGASRAGRAEYLKTFKVAYSLDGRKFEFIQDESGGDKEFLGNLDNNSLKVNMFNPTLEAQYIKLYPVSCHRGCTLRFELLGCELHGCSEPLGLKNNTIPDSQMSASSSYKTWNLRAFGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQRQVTGIITQGARDFGHIQYVASYKVAHSDDGVQWTVYEEQGSSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPVSWHNRITLRLELLGC

Molecular Formula

17304 (Gene_ID) P21956 (A23-C463) (Accession)

Molecular Weight

Approximately 60-75 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM98C Protein Vector (Mouse) (pPM-C-His)
PV178265 500 ng

FAM98C Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Human Gamma-synuclein
MBS9420687-01 0.02 mg

Recombinant Human Gamma-synuclein

Sign In for Pricing
View Details
Recombinant Human Gamma-synuclein
MBS9420687-02 0.1 mg

Recombinant Human Gamma-synuclein

Sign In for Pricing
View Details
Recombinant Human Gamma-synuclein
MBS9420687-03 1 mg

Recombinant Human Gamma-synuclein

Sign In for Pricing
View Details
Recombinant Human Gamma-synuclein
MBS9420687-04 5x 1 mg

Recombinant Human Gamma-synuclein

Sign In for Pricing
View Details
Dengue virus NS1 discontinued
532416 100 µg

Dengue virus NS1 discontinued

Sign In for Pricing
View Details