Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFG-E8, Mouse (HEK293, His)

The MFG-E8 protein plays a critical role in promoting the phagocytic clearance of apoptotic cells in various tissues.As a specific ligand, it interacts with alpha-v/beta-3 and alpha-v/beta-5 receptors and also binds independently to phosphatidylserine-rich cell surfaces.MFG-E8 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MFG-E8 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

MFG-E8 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mfg-e8-protein-mouse-hek293-his.html

Purity

97.0

Smiles

ASGDFCDSSLCLNGGTCLTGQDNDIYCLCPEGFTGLVCNETERGPCSPNPCYNDAKCLVTLDTQRGDIFTEYICQCPVGYSGIHCETETNYYNLDGEYMFTTAVPNTAVPTPAPTPDLSNNLASRCSTQLGMEGGAIADSQISASSVYMGFMGLQRWGPELARLYRTGIVNAWTASNYDSKPWIQVNLLRKMRVSGVMTQGASRAGRAEYLKTFKVAYSLDGRKFEFIQDESGGDKEFLGNLDNNSLKVNMFNPTLEAQYIKLYPVSCHRGCTLRFELLGCELHGCSEPLGLKNNTIPDSQMSASSSYKTWNLRAFGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQRQVTGIITQGARDFGHIQYVASYKVAHSDDGVQWTVYEEQGSSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPVSWHNRITLRLELLGC

Molecular Formula

17304 (Gene_ID) P21956 (A23-C463) (Accession)

Molecular Weight

Approximately 60-75 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Glutathione Reductase Antibody [FITC]
NBP2-97945F 0.1 mL

Rabbit Polyclonal Glutathione Reductase Antibody [FITC]

Sign In for Pricing
View Details
RGD1564614 3'UTR GFP Stable Cell Line
TU268995 1.0 mL

RGD1564614 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Innovative Grade US Origin Porcine Adipose Tissue Fresh in PBS 500gm
IGPCADPTP500GM 500 g

Innovative Grade US Origin Porcine Adipose Tissue Fresh in PBS 500gm

Sign In for Pricing
View Details
GABBR2, CT (GABBR2, GPR51, GPRC3B, Gamma-aminobutyric acid type B receptor subunit 2, G-protein coupled receptor 51, HG20) (MaxLight 650)
MBS6300793-01 0.1 mL

GABBR2, CT (GABBR2, GPR51, GPRC3B, Gamma-aminobutyric acid type B receptor subunit 2, G-protein coupled receptor 51, HG20) (MaxLight 650)

Sign In for Pricing
View Details
GABBR2, CT (GABBR2, GPR51, GPRC3B, Gamma-aminobutyric acid type B receptor subunit 2, G-protein coupled receptor 51, HG20) (MaxLight 650)
MBS6300793-02 5x 0.1 mL

GABBR2, CT (GABBR2, GPR51, GPRC3B, Gamma-aminobutyric acid type B receptor subunit 2, G-protein coupled receptor 51, HG20) (MaxLight 650)

Sign In for Pricing
View Details
(S) -3- ((tert-Butoxycarbonyl) amino) -4- (p-tolyl) butanoic acid
OR81856-01 100 mg

(S) -3- ((tert-Butoxycarbonyl) amino) -4- (p-tolyl) butanoic acid

Sign In for Pricing
View Details