Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 sigma, Mouse

14-3-3 sigma proteins are adapter proteins in various signaling pathways that bind to phosphoserine or phosphothreonine motifs to regulate chaperone activity. When bound to KRT17, it stimulates the regulation of protein synthesis and cell growth through the Akt/mTOR pathway. 14-3-3 sigma Protein, Mouse is the recombinant mouse-derived 14-3-3 sigma protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

14-3-3 sigma Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-sigma-protein-mouse.html

Purity

95.00

Smiles

MERASLIQKAKLAEQAERYEDMAAFMKSAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVKEYREKVETELRGVCDTVLGLLDSHLIKGAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADSAGEEGGEAPEEPQS

Molecular Formula

55948 (Gene_ID) O70456 (M1-S248) (Accession)

Molecular Weight

Approximately 32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vari Fluor 640 SE
HY-D1790 1 mg

Vari Fluor 640 SE

Sign In for Pricing
View Details
Phospho-CaMKII (Thr305) Rabbit Polyclonal Antibody
APRab00792-01 20 µL

Phospho-CaMKII (Thr305) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-CaMKII (Thr305) Rabbit Polyclonal Antibody
APRab00792-02 50 µL

Phospho-CaMKII (Thr305) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-CaMKII (Thr305) Rabbit Polyclonal Antibody
APRab00792-03 100 µL

Phospho-CaMKII (Thr305) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-CaMKII (Thr305) Rabbit Polyclonal Antibody
APRab00792-04 200 µL

Phospho-CaMKII (Thr305) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Amplirun® Total Atypical Bacterial Pneumonia Control (Swab)
MBTC022-R 10 Vials

Amplirun® Total Atypical Bacterial Pneumonia Control (Swab)

Sign In for Pricing
View Details