Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 sigma, Mouse

14-3-3 sigma proteins are adapter proteins in various signaling pathways that bind to phosphoserine or phosphothreonine motifs to regulate chaperone activity. When bound to KRT17, it stimulates the regulation of protein synthesis and cell growth through the Akt/mTOR pathway. 14-3-3 sigma Protein, Mouse is the recombinant mouse-derived 14-3-3 sigma protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

14-3-3 sigma Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-sigma-protein-mouse.html

Purity

95.00

Smiles

MERASLIQKAKLAEQAERYEDMAAFMKSAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVKEYREKVETELRGVCDTVLGLLDSHLIKGAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADSAGEEGGEAPEEPQS

Molecular Formula

55948 (Gene_ID) O70456 (M1-S248) (Accession)

Molecular Weight

Approximately 32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Acidovorax citrulli Disulfide bond formation protein B (dsbB)
orb2919888-01 20 µg

Recombinant Acidovorax citrulli Disulfide bond formation protein B (dsbB)

Sign In for Pricing
View Details
Recombinant Acidovorax citrulli Disulfide bond formation protein B (dsbB)
orb2919888-02 100 µg

Recombinant Acidovorax citrulli Disulfide bond formation protein B (dsbB)

Sign In for Pricing
View Details
Genesig kit for Mycobacterium leprae and Mycobacterium lepromatosis, Easy
348561 1 Kit

Genesig kit for Mycobacterium leprae and Mycobacterium lepromatosis, Easy

Sign In for Pricing
View Details
Human EGFR (Epidermal Growth Factor Receptor) Microsample ELISA Kit
orb2998906-01 48 Tests

Human EGFR (Epidermal Growth Factor Receptor) Microsample ELISA Kit

Sign In for Pricing
View Details
Human EGFR (Epidermal Growth Factor Receptor) Microsample ELISA Kit
orb2998906-02 96 Tests

Human EGFR (Epidermal Growth Factor Receptor) Microsample ELISA Kit

Sign In for Pricing
View Details
GCGR Antibody : FITC (OAAF04902-FITC)
OAAF04902-100UG-FITC 100 µg

GCGR Antibody : FITC (OAAF04902-FITC)

Sign In for Pricing
View Details