Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 sigma, Mouse

14-3-3 sigma proteins are adapter proteins in various signaling pathways that bind to phosphoserine or phosphothreonine motifs to regulate chaperone activity. When bound to KRT17, it stimulates the regulation of protein synthesis and cell growth through the Akt/mTOR pathway. 14-3-3 sigma Protein, Mouse is the recombinant mouse-derived 14-3-3 sigma protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

14-3-3 sigma Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-sigma-protein-mouse.html

Purity

95.00

Smiles

MERASLIQKAKLAEQAERYEDMAAFMKSAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVKEYREKVETELRGVCDTVLGLLDSHLIKGAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADSAGEEGGEAPEEPQS

Molecular Formula

55948 (Gene_ID) O70456 (M1-S248) (Accession)

Molecular Weight

Approximately 32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Papss1 AAV siRNA Pooled Vector
35997164 1.0 µg

Papss1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Phospho-Paxillin (Tyr88) Rabbit Polyclonal Antibody (Cy7)
orb1085286 100 µL

Phospho-Paxillin (Tyr88) Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Ccdc48 3'UTR Luciferase Stable Cell Line
TU201803 1.0 mL

Ccdc48 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-Zebrafish DHX9 Antibody Fluoro550 Conjugated
AZA0A8M3AQB4-Fluoro550 100 µg/Vial

Anti-Zebrafish DHX9 Antibody Fluoro550 Conjugated

Sign In for Pricing
View Details
Lentiviral human SLC25A10 sgRNA gene knockout kit - Lentiviral human SLC25A10 sgRNA gene knockout kit (plasmid)
GTR15362816 1 Vial

Lentiviral human SLC25A10 sgRNA gene knockout kit - Lentiviral human SLC25A10 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Rat ACADVL shRNA Plasmid
abx984961-01 150 µg

Rat ACADVL shRNA Plasmid

Sign In for Pricing
View Details