Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Human (HEK293, His, solution)

AG-2 Protein, Human (HEK293, His, solution) is human recombinant AG-2 with a N-terminal His tag. AG-2 Protein, Human (HEK293, His) is expressed in HEK293 cells.

Product Specifications

Product Name Alternative

AG-2 Protein, Human (HEK293, His, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-human-hek293-his.html

Purity

97.34

Smiles

RDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTELHHHHHH

Molecular Formula

10551 (Gene_ID) O95994 (R21-L175) (Accession)

Molecular Weight

Approximately 18.0 kDa

References & Citations

[1]Pan F, et al. Anterior gradient 2 as a supervisory marker for tumor vessel normalization induced by anti-angiogenic treatment. Oncol Lett. 2018 Sep;16 (3) :3083-3091.|[2]Luu TT, et al. Overexpression of AGR2 Is Associated With Drug Resistance in Mutant Non-small Cell Lung Cancers. Anticancer Res. 2020 Apr;40 (4) :1855-1866.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Benzamido-1,4-naphthoquinone
TRC-B184990-10MG 10 mg

2-Benzamido-1,4-naphthoquinone

Sign In for Pricing
View Details
TPM4 Polyclonal Antibody
E-AB-67605-01 60 µL

TPM4 Polyclonal Antibody

Sign In for Pricing
View Details
TPM4 Polyclonal Antibody
E-AB-67605-02 120 µL

TPM4 Polyclonal Antibody

Sign In for Pricing
View Details
TPM4 Polyclonal Antibody
E-AB-67605-03 200 µL

TPM4 Polyclonal Antibody

Sign In for Pricing
View Details
Ethyl Valerate
TRC-E289271-100MG 100 mg

Ethyl Valerate

Sign In for Pricing
View Details
Creatine Kinase-BB (CK-BB) (CKB/1268), 1mg/mL
BNUM1268-50 1x 50 µL

Creatine Kinase-BB (CK-BB) (CKB/1268), 1mg/mL

Sign In for Pricing
View Details