Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Human (HEK293, His, solution)

AG-2 Protein, Human (HEK293, His, solution) is human recombinant AG-2 with a N-terminal His tag. AG-2 Protein, Human (HEK293, His) is expressed in HEK293 cells.

Product Specifications

Product Name Alternative

AG-2 Protein, Human (HEK293, His, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-human-hek293-his.html

Purity

97.34

Smiles

RDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTELHHHHHH

Molecular Formula

10551 (Gene_ID) O95994 (R21-L175) (Accession)

Molecular Weight

Approximately 18.0 kDa

References & Citations

[1]Pan F, et al. Anterior gradient 2 as a supervisory marker for tumor vessel normalization induced by anti-angiogenic treatment. Oncol Lett. 2018 Sep;16 (3) :3083-3091.|[2]Luu TT, et al. Overexpression of AGR2 Is Associated With Drug Resistance in Mutant Non-small Cell Lung Cancers. Anticancer Res. 2020 Apr;40 (4) :1855-1866.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Active Epidermal Growth Factor (EGF)
TRV-0001737-01 10 µg

Active Epidermal Growth Factor (EGF)

Sign In for Pricing
View Details
Active Epidermal Growth Factor (EGF)
TRV-0001737-02 50 µg

Active Epidermal Growth Factor (EGF)

Sign In for Pricing
View Details
Active Epidermal Growth Factor (EGF)
TRV-0001737-03 100 µg

Active Epidermal Growth Factor (EGF)

Sign In for Pricing
View Details
Active Epidermal Growth Factor (EGF)
TRV-0001737-04 200 µg

Active Epidermal Growth Factor (EGF)

Sign In for Pricing
View Details
Active Epidermal Growth Factor (EGF)
TRV-0001737-05 500 µg

Active Epidermal Growth Factor (EGF)

Sign In for Pricing
View Details
Active Epidermal Growth Factor (EGF)
TRV-0001737-06 1 mg

Active Epidermal Growth Factor (EGF)

Sign In for Pricing
View Details