Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sclerostin (SOST), Biotinylated

Product Specifications

Abbreviation

Recombinant Human SOST protein, Biotinylated

Gene Name

SOST

UniProt

Q9BQB4

Expression Region

24-213aa

Organism

Homo sapiens (Human)

Target Sequence

QGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY

Tag

N-terminal 10xHis-tagged and C-terminal Avi-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

Negative regulator of bone growth that acts through inhibition of Wnt signaling and bone formation.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DGKA Mouse Monoclonal Antibody [Clone 7B6]
E45M12146V-2 50 µL

DGKA Mouse Monoclonal Antibody [Clone 7B6]

Sign In for Pricing
View Details
Desmoglein 3 Polyclonal Antibody, APC Conjugated
bs-6585R-APC-01 20 µL

Desmoglein 3 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Desmoglein 3 Polyclonal Antibody, APC Conjugated
bs-6585R-APC-02 100 µL

Desmoglein 3 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Anti-VEGF Receptor 2 Rabbit pAb
GB11190 100 μL

Anti-VEGF Receptor 2 Rabbit pAb

Sign In for Pricing
View Details
Porcine MSH ELISA Kit
EPM0350 96 Tests

Porcine MSH ELISA Kit

Sign In for Pricing
View Details
SEPT4 Antibody
MBS8590739-01 0.1 mg

SEPT4 Antibody

Sign In for Pricing
View Details