Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sclerostin (SOST), Biotinylated

Product Specifications

Abbreviation

Recombinant Human SOST protein, Biotinylated

Gene Name

SOST

UniProt

Q9BQB4

Expression Region

24-213aa

Organism

Homo sapiens (Human)

Target Sequence

QGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY

Tag

N-terminal 10xHis-tagged and C-terminal Avi-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

Negative regulator of bone growth that acts through inhibition of Wnt signaling and bone formation.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Voclosporin 5mg
A20213-5 5 mg

Voclosporin 5mg

Sign In for Pricing
View Details
Atrial Natriuretic Peptide, NT (ANP, Atrial Natriuretic Factor, ANF, ATFB6, Cardiodilatin-related Peptide, CDP, CDD-ANF, Natriuretic Peptide Precursor A, NPPA, Prepronatriodilatin, PND)
A4150-01N 200 µL

Atrial Natriuretic Peptide, NT (ANP, Atrial Natriuretic Factor, ANF, ATFB6, Cardiodilatin-related Peptide, CDP, CDD-ANF, Natriuretic Peptide Precursor A, NPPA, Prepronatriodilatin, PND)

Sign In for Pricing
View Details
Akap4 (NM_001042542) Mouse Tagged Lenti ORF Clone
MR219020L4 10 µg

Akap4 (NM_001042542) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Carbonic Anhydrase I (CA1) (NM_001291967) Human Untagged Clone
SC334371 10 µg

Carbonic Anhydrase I (CA1) (NM_001291967) Human Untagged Clone

Sign In for Pricing
View Details
Antimicrobial Compound 1 1mg
A20189-1 1 mg

Antimicrobial Compound 1 1mg

Sign In for Pricing
View Details
TMC2 siRNA (Mouse)
CRN1428-01 15 nmol

TMC2 siRNA (Mouse)

Sign In for Pricing
View Details