Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Forkhead box protein D3 (Foxd3)

Product Specifications

Product Name Alternative

HNF3/FH transcription factor genesis; Hepatocyte nuclear factor 3 forkhead homolog 2; HFH-2

Abbreviation

Recombinant Rat Foxd3 protein

Gene Name

Foxd3

UniProt

Q63245

Expression Region

1-101aa

Organism

Rattus norvegicus (Rat)

Target Sequence

LVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGSFLRRRKRFKR

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Developmental Biology

Relevance

Binds to the consensus sequence 5'-A[AT]T[AG]TTTGTTT-3' and acts as a transcriptional repressor. Also acts as a transcriptional activator. Promotes development of neural crest cells from neural tube progenitors. Restricts neural progenitor cells to the neural crest lineage while suppressing interneuron differentiation. Required for maintenance of pluripotent cells in the pre-implantation and peri-implantation stages of embryogenesis.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GIGYF2 Rabbit Polyclonal Antibody (Fluoro550)
orb3105995 100 µg

GIGYF2 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
UXT Antibody
MBS8593432-01 0.1 mg

UXT Antibody

Sign In for Pricing
View Details
UXT Antibody
MBS8593432-02 0.1 mL (AF405L)

UXT Antibody

Sign In for Pricing
View Details
UXT Antibody
MBS8593432-03 0.1 mL (AF405S)

UXT Antibody

Sign In for Pricing
View Details
UXT Antibody
MBS8593432-04 0.1 mL (AF610)

UXT Antibody

Sign In for Pricing
View Details
UXT Antibody
MBS8593432-05 0.1 mL (AF635)

UXT Antibody

Sign In for Pricing
View Details