Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Pulmonary surfactant-associated protein B (SFTPB)

Product Specifications

Product Name Alternative

6KDA protein; Pulmonary surfactant-associated proteolipid SPL (Phe)

Abbreviation

Recombinant Bovine SFTPB protein

Gene Name

SFTPB

UniProt

P15781

Expression Region

188-266aa

Organism

Bos taurus (Bovine)

Target Sequence

FPIPIPYCWLCRTLIKRIQAVIPKGVLAMTVAQVCHVVPLLVGGICQCLVERYSVILLDTLLGRMLPQLVCGLVLRCSS

Tag

Tag-Free

Type

In Stock Protein

Source

Yeast

Field of Research

Cell Biology

Relevance

Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

8.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL
BNC680679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL
BNC680040-100 1x 100 µL

CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL
BNC000437-100 1x 100 µL

CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF405S conjugate, 0.1mg/mL
BNC040322-500 1x 500 µL

CD3e (RIV9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL
BNC041231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL
BNC881037-500 1x 500 µL

CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details