Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRISP-1, Mouse (HEK293, His)

CRISP-1 protein plays a crucial role in promoting the functional maturation of spermatozoa during their transition from the testis to the ductus deferens. Its involvement underscores its significance in the complex regulatory network governing male reproductive physiology, emphasizing its potential impact on sperm functionality and fertility as these cells navigate through the reproductive tract. CRISP-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CRISP-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CRISP-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/crisp-1-protein-mouse-hek293-his.html

Purity

98.0

Smiles

QDSSQENRLEKLSTTKMSVQEEIVSKHNQLRRMVSPSGSDLLKMEWNYDAQVNAQQWADKCTFSHSPIELRTTNLRCGENLFMSSYLASWSSAIQGWYNEYKDLTYDVGPKQPDSVVGHYTQVVWNSTFQVACGVAECPKNPLRYYYVCHYCPVGNYQGRLYTPYTAGEPCASCPDHCEDGLCTNSCGHEDKYTNCKYLKKMLSCEHELLKKGCKATCLCEGKIH

Molecular Formula

11571 (Gene_ID) Q03401 (Q20-H244) (Accession)

Molecular Weight

Approximately 26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL
BNC550146-500 1x 500 µL

CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL
BNC941050-500 1x 500 µL

CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL
BNC740026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF770 conjugate, 0.1mg/mL
BNC701052-100 1x 100 µL

CD3e (B-B12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF640R conjugate, 0.1mg/mL
BNC400305-500 1x 500 µL

CD95 (B-R18), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC3 (Mucin 3) (MUC3/2992R), CF740 conjugate, 0.1mg/mL
BNC742992-100 1x 100 µL

MUC3 (Mucin 3) (MUC3/2992R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details