Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Glycoprotein hormones alpha chain (CGA)

Product Specifications

Product Name Alternative

Anterior pituitary glycoprotein hormones common subunit alpha; Follicle-stimulating hormone alpha chain; FSH-alpha; Follitropin alpha chain; Luteinizing hormone alpha chain; LSH-alpha; Lutropin alpha chain; Thyroid-stimulating hormone alpha chain; TSH-alpha; Thyrotropin alpha chain

Abbreviation

Recombinant Dog CGA protein

Gene Name

CGA

UniProt

Q9XSW8

Expression Region

25-120aa

Organism

Canis lupus familiaris (Dog) (Canis familiaris)

Target Sequence

FPDGEFTMQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNAKVENHTECHCSTCYYHKS

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.1 kDa

References & Citations

"cDNA cloning of canine common alpha gene and its co-expression with canine thyrotropin beta gene in baculovirus expression system." Yang X., McGraw R.A., Ferguson D.C. Domest. Anim. Endocrinol. 18:379-393 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AARSD1 Polyclonal Conjugated Antibody
MBS9443157-01 0.1 mL (Biotin)

AARSD1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
AARSD1 Polyclonal Conjugated Antibody
MBS9443157-02 0.1 mL (AF350)

AARSD1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
AARSD1 Polyclonal Conjugated Antibody
MBS9443157-03 0.1 mL (AF405)

AARSD1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
AARSD1 Polyclonal Conjugated Antibody
MBS9443157-04 0.1 mL (AF488)

AARSD1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
AARSD1 Polyclonal Conjugated Antibody
MBS9443157-05 0.1 mL (AF555)

AARSD1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
AARSD1 Polyclonal Conjugated Antibody
MBS9443157-06 0.1 mL (AF594)

AARSD1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details